KEGG   Tabrizicola sp. K13M18: EI545_07015Help
Entry
EI545_07015       CDS       T05742                                 

Definition
(GenBank) ADP-forming succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
taw  Tabrizicola sp. K13M18
Pathway
taw00020  Citrate cycle (TCA cycle)
taw00640  Propanoate metabolism
taw00660  C5-Branched dibasic acid metabolism
taw01100  Metabolic pathways
taw01110  Biosynthesis of secondary metabolites
taw01120  Microbial metabolism in diverse environments
taw01130  Biosynthesis of antibiotics
taw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:taw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EI545_07015
   00640 Propanoate metabolism
    EI545_07015
   00660 C5-Branched dibasic acid metabolism
    EI545_07015
Enzymes [BR:taw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EI545_07015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AZL58607
UniProt: A0A3S8U4T3
Position
1461755..1462948
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLRSYGIPVSDGRVVLRAEEAKTAAGELDGPLWVVKAQIHAGGRGKGHFK
EPEAGEKGGVRLARSVGEAAEFARQMLGRTLVTIQTGETGKQVNRIYIEDGSDIDREFYL
AFLIDRQTSRISIVASTEGGMSIEDVAHNTPEKIHTFTIDPATGLQDFHGRRVAFALGLS
GAQVKSCVGIVKNLYRMFTDKDMDMLEINPFCVLKDGSLKLLDAKMAFDGNAIYRHPDIA
ALRDETEEDPKELAASKFDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTEAFKIITSDPQVKGILVNIFGGIMRCDIIAEGVIAAVKEVGLKVPLVVRLE
GTNVDLGKDIIRKSGLNVIAADDLKDGAEKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaggcgaaggcgcttttgcgcagctatggcatcccggtcagc
gacggccgcgtcgtcctgcgggcagaagaggccaagaccgccgccggggaacttgacggg
ccgctctgggtcgtcaaggcgcagatccatgcgggcgggcgcggcaaaggccatttcaag
gaacccgaggctggcgaaaagggcggtgtccgtctggcccgttcagtgggtgaggccgcc
gaatttgcccgccagatgctgggccgcacgctggtgacgatccagacgggtgagaccggc
aagcaggtcaaccgcatctacatcgaagacggcagcgatattgaccgcgagttctacctt
gccttcctgatcgaccgtcagaccagccgcatctccatcgtcgcctcgaccgagggcggg
atgagcatcgaggacgttgcccacaacacgcccgagaagatccacaccttcaccatcgac
cccgccaccgggctgcaggatttccacggccgccgcgtcgcctttgcgctggggctgtcg
ggcgcgcaggtcaaatcctgcgtcgggatcgtcaagaacctgtaccgcatgttcaccgac
aaggacatggacatgctggagatcaacccgttctgcgtgctgaaggatgggtcgttgaag
ctgctggatgccaagatggccttcgacggcaacgcgatctatcgccaccctgatattgcg
gctttgcgtgacgagacggaggaagacccgaaagaactcgccgcgtcgaagttcgacctg
aactacatcgcgctggatggcgagatcggctgcatggtcaacggcgcaggtctggcgatg
gccacgatggacatcatcaagctttacggcgctgagcctgccaacttccttgacgtgggc
ggtggcgcgaccaaggagaaggtgaccgaggcgttcaagatcatcacctcggacccgcag
gtgaagggcattctggtcaacatcttcggcggcatcatgcgctgcgacatcatcgccgaa
ggcgtgatcgcggcggtgaaggaagtgggcctgaaggtcccgctggtggtgcgcctggaa
gggacgaacgtcgatctgggcaaggacatcatccgcaagagcggcctgaacgtcattgcc
gccgatgacctgaaggacggggccgagaagatcgtgaaggccgtcaagggatga

DBGET integrated database retrieval system