KEGG   Tabrizicola sp. K13M18: EI545_15360Help
Entry
EI545_15360       CDS       T05742                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
taw  Tabrizicola sp. K13M18
Pathway
taw00220  Arginine biosynthesis
taw01100  Metabolic pathways
taw01110  Biosynthesis of secondary metabolites
taw01130  Biosynthesis of antibiotics
taw01230  Biosynthesis of amino acids
Module
taw_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:taw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EI545_15360 (argF)
Enzymes [BR:taw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     EI545_15360 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AZL60086
UniProt: A0A3S8U8V0
Position
3164219..3165145
Genome map
AA seq 308 aa AA seqDB search
MKHFLDIHKTDPAALRAMIDTAQAMKAARNGRPKGSPDDETPLKGRMVALIFEKPSTRTR
VSFDVGVRQLGGETMVLSGKEMQLGHGETIADTARVLSRYVDLIMIRTFEEATLLEMAEH
ATVPVINGLTNRTHPCQIMADVMTYEEHRGPIAGKKVVWCGDGNNVCGSFLHAAGQFGFD
FTFTGPETLDPEDKFVAFAREKGSKITIQRDPFTAVEGADLVVTDTWVSMHDPESAKERR
HNQLRPYQVNEQLMTRAKPDALFMHCLPAHRNDEATSAVMDGPHSVIFDEAENRLHAQKA
VMRWCLGV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacttcctggatatccacaagaccgatcccgctgcgctgcgggccatgatcgac
accgcgcaggcgatgaaggccgcccgcaatgggcggccaaagggatcgcccgatgacgag
accccgctgaaaggtcgcatggtcgcgctgatcttcgaaaagccctcgacccgcacccgc
gtttcctttgacgtgggtgtgcgccagttgggcggggaaaccatggtcctttccggcaag
gaaatgcagcttggccacggcgagacgattgccgacaccgcgcgggtcctgtcgcgctat
gtcgatctgatcatgatccgcacgttcgaggaggcgaccctgctggagatggcagagcat
gccaccgtccccgtcatcaacgggctgaccaatcgcacgcatccctgccagatcatggcc
gatgtcatgacctatgaggaacaccgtggcccgatcgccggcaagaaggtggtctggtgc
ggcgacggcaacaacgtttgcggcagctttctgcatgcggccgggcagttcggctttgac
ttcacctttaccgggcccgaaacccttgacccggaagacaagttcgtggccttcgcgcgg
gaaaagggcagcaagatcaccatccagcgcgaccccttcacagcggtggagggcgctgat
cttgtcgtcaccgacacctgggtctcgatgcacgacccggaatcggccaaggaacgccgc
cacaaccagcttcgcccctatcaggtgaacgaacagctgatgacccgcgccaagccagac
gcgcttttcatgcattgccttcccgcgcatcgcaatgacgaggcgaccagtgccgtcatg
gatggcccgcattcggtgatcttcgacgaggccgagaaccgcctgcatgcgcaaaaggcc
gtcatgcgctggtgccttggcgtctag

DBGET integrated database retrieval system