KEGG   Treponema azotonutricium: TREAZ_0056Help
Entry
TREAZ_0056        CDS       T01506                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
taz  Treponema azotonutricium
Pathway
taz00051  Fructose and mannose metabolism
taz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TREAZ_0056
Enzymes [BR:taz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     TREAZ_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEF82784
UniProt: F5YFM0
Position
2423418..2424623
Genome map
AA seq 401 aa AA seqDB search
MKAVMYGAGNIGRGFIGQLFAASGYEVTFIDVAEPVIDAINREGKYPVRLLSSSGHEDVW
VEGVKAINGRDIQKAAEAIAGADIMATAVGVRVLPFIAPVLAEGIRNRFSKTTAPLNIII
CENLIDANKLLERLIKEKLDTEGTKLFNERVGLVEASIGRMVPIQTEAMQDGNPLRVCTE
HYGFLPVDKDAFKGEIPEIKNMKPFGCFDFYIHRKLFIHNMGHAICAYLGMLKSDTFIYE
TVKRGDILYIAQNAMMESALALSAKFKIPIEDIYFHIKDLLSRFSNKALGDTCARVGGDT
VRKLGPNDRLIGAINCCNAMGISPGFISAGAGAALYCHLKEKNLPQTREAAEAALAEVSG
LAKGAGEAALILNMHGLFAKGAEFSEAIRAATEAGNRKDII
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgatgtacggcgccggcaatataggcaggggttttataggccagcttttt
gctgcgtcgggttatgaagttacttttattgatgtggctgagcctgtcatcgacgccatt
aaccgggaagggaaataccctgtaaggctgctctcttcctccggccatgaggatgtttgg
gttgaaggggtaaaggcgataaacggcagggatattcaaaaagcagccgaggctatagca
ggggccgacatcatggcaactgcagttggggtgagggtactcccctttattgcgcctgtc
ctcgctgaggggatacggaacagattttcaaaaacaacggctcctctcaatatcatcatt
tgcgaaaatctcattgacgcaaacaagctccttgaaaggctcatcaaagaaaaattggat
actgaaggaacaaagctttttaatgaacgtgtcgggcttgtggaagcttccatagggcgc
atggttcccatacagaccgaagcgatgcaggacggaaatcccttgcgggtttgtactgaa
cattacggcttcctgcctgtggacaaagatgcctttaagggcgagattccggaaattaaa
aacatgaagccctttggctgcttcgatttttatatacatcgcaaactttttattcacaac
atgggtcacgctatttgtgcctacctggggatgcttaagtctgatacctttatttacgaa
acggttaaacggggcgacatactctatattgcccagaatgcaatgatggaaagcgccctg
gcactttcagcaaaatttaaaatccccattgaagatatttactttcatattaaggatctt
ttaagccgtttttccaacaaagccctgggcgacacctgtgccagggtcggcggggatacg
gtacgcaagctcggccccaatgacaggctcataggcgccattaattgctgcaacgccatg
ggcattagtcccggttttatttcggcaggcgcaggggctgccctctattgccacctcaaa
gaaaaaaatcttccccaaaccagggaggctgccgaagctgcgctggcggaagtttcgggc
cttgccaaaggagcgggggaagcagcactcatactgaatatgcatgggctttttgccaaa
ggcgcagagttctccgaagcaatcagggcagcaacagaggcaggaaacaggaaagacatc
atctag

DBGET integrated database retrieval system