KEGG   Treponema azotonutricium: TREAZ_0745Help
Entry
TREAZ_0745        CDS       T01506                                 

Definition
(GenBank) alpha-galactosidase (Melibiase)
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
taz  Treponema azotonutricium
Pathway
taz00052  Galactose metabolism
taz00561  Glycerolipid metabolism
taz00600  Sphingolipid metabolism
taz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TREAZ_0745
  Lipid metabolism
   00561 Glycerolipid metabolism
    TREAZ_0745
   00600 Sphingolipid metabolism
    TREAZ_0745
Enzymes [BR:taz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TREAZ_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N zf-LITAF-like
Motif
Other DBs
NCBI-ProteinID: AEF82979
UniProt: F5YA86
Position
1738421..1739755
Genome map
AA seq 444 aa AA seqDB search
MAKFAFIGAGSFGFTRGLVKDILSFDAFKDATIALMDINDERLAYITRAVEKIIKAGNYA
AKVVSTKSRAEALAGADGVLCTILNGDVDVWRYDIEIPKEFGVDINVGDTRGPSGIFRAL
RTIPVMLDICKDIEKYCPNATFLNYTNPMAMLCRAMQSKFPKLRISGLCHSVQGTAEMLA
KWIGADPGDISFTCAGINHQAFYLDYRWKGVDAYPRIREALKDPKVYNEEIVRNEMYLLL
DYYPTESSGHNSEYNAWFRKRPDLIEKFCIPGTGWNPGAYAYILKEYENRKGTWKKDWDE
WLANPEVDLKRGHEYAAYIFNAVFGDKTLFKFNGNVLNKGFIDNLPQDACVEVPVLASPH
GLEAIKVGKLPNQLAALVHTSAICEELAVDGSLTGDPRKVYQAIAFDPLTSAVLGIHEIK
DMTEKMLLRNKDYLPQFSTYTVGK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattcgcatttatcggcgccgggagcttcggcttcaccagggggttggttaag
gatatcctttctttcgacgccttcaaggatgccactatcgcactcatggacatcaatgac
gagaggctggcgtacatcaccagggcagtggaaaagatcataaaggccgggaactatgcg
gccaaggtcgtctccaccaagagcagggcggaggccctcgcaggggccgacggcgtgctt
tgcaccatacttaacggcgacgtggacgtgtggcgctatgacattgaaatccccaaggaa
ttcggggtggacatcaacgtgggcgacacccgggggccttcgggcatattcagggccctc
cgcaccatcccggtgatgctggatatttgcaaggacattgaaaagtactgccccaacgca
accttcctcaactacaccaaccccatggccatgctttgccgtgccatgcaaagcaaattc
cccaaattgaggatttcgggcctctgccacagcgtgcaggggactgcggaaatgcttgcc
aagtggataggcgccgaccctggcgacatcagctttacctgcgccggcatcaaccaccag
gctttttacctggattatcgctggaagggcgtcgacgcctaccccaggatcagggaagcc
ctgaaagacccgaaagtctacaatgaggaaatcgtgcggaacgagatgtacctgctcctg
gattactatcctaccgaatcttcggggcacaactcggaatacaacgcatggttccgcaag
cggcccgacctgattgagaaattctgcatcccgggcacagggtggaaccccggcgcctat
gcctatatcctcaaggaatacgagaaccgcaagggcacctggaagaaggattgggacgaa
tggcttgcgaaccccgaggtggatctgaagcggggccatgaatacgcggcctatatattc
aatgccgttttcggggacaagacccttttcaaattcaacgggaatgtgctgaacaagggt
tttatcgacaacctcccccaggatgcctgcgtggaagtgccggtgctggcttccccccac
gggcttgaggccatcaaggtggggaagctccccaaccagctcgcggccctggtgcatacc
tcggcaatctgcgaggagcttgcagtggacggctccctcacaggggatccccgcaaggtg
taccaggccattgcattcgatcccctgacttcggcagtcctgggcatacatgaaatcaag
gatatgaccgaaaagatgctcctccggaacaaggattaccttccccaattttcaacttat
acggttggcaaataa

DBGET integrated database retrieval system