KEGG   Treponema azotonutricium: TREAZ_1389Help
Entry
TREAZ_1389        CDS       T01506                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
taz  Treponema azotonutricium
Pathway
taz00670  One carbon pool by folate
taz01100  Metabolic pathways
taz01120  Microbial metabolism in diverse environments
taz01200  Carbon metabolism
Module
taz_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:taz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TREAZ_1389 (fhs)
Enzymes [BR:taz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     TREAZ_1389 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AEF80122
UniProt: F5YFB5
Position
1008038..1009777
Genome map
AA seq 579 aa AA seqDB search
MNKSDIEIAREAKLKPISEIAGAMGISPQWVEEYGKYKAKIDWRLLKSAELPQKRAKYIN
ITAISPTPLGEGKTTTTVGLVQGLGKIGKQAVACLRQPSMGPTFGIKGGAAGGGYSQIVP
MEDFNLHLTGDIHAVSAAHNLCAAAVDARIYHESRWAPSYFEKLGLKILDIDPCRVSLGR
VMDINDRGLRNVMTGLGGREDGPLRQSRFDISVASEVMAILALARDLPDLRKRLGRMVAA
CNKKGDPVTAEDLGVAGAMTVLMKDALKPNLLQTIEGQGSFVHAGPFANIAHGNSSIIAD
LLAVNYADFVVTEAGFGSDMGMEKFFDIKCRTSGLVPDAVVLVATVRALKSHGGGPAVVP
GKPLPPEYKEENLELLKKGLPNLLAHIGIISRFGVPAVVAINAFPTDTEAEWELVRDAAI
KAGAADAVVTTHWANGGEGAADLARAVEKAASLPSHFKLLYPDEVPLKQKIETVAVRVYG
AEGVDFEKGVLKELDTLEEKGYGKLPVCMAKTQYSLSHDPALKGAPRGWRLPVREVRLAA
GAGFVYPLCGAITTMPGLPSRPAFMDVDIDDDGTVRGLF
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatcggatatcgaaattgcccgggaagccaagcttaagccaatttcagaaata
gctggcgctatggggatttccccccaatgggtggaggaatacggaaagtacaaagccaag
atagactggaggctgctaaaatctgcggaattgccccaaaagcgggcgaagtatataaac
attaccgccatttcgccaacacccctgggggaggggaagaccaccacaactgtggggctg
gttcagggcctggggaaaatcgggaagcaggctgtagcttgtctcaggcagccttccatg
gggcctaccttcggcatcaagggaggggcagccggcggagggtacagccaaattgttcca
atggaggatttcaacctccacctcaccggagatatacatgccgtgtccgctgcccacaac
ctctgcgcagctgcggtggatgcccggatctaccacgagtcccgctgggccccgtcttac
tttgaaaagctgggcctcaaaatactggacattgacccttgcagggtgtccctgggccgg
gtgatggatattaacgaccggggcctccgcaatgtgatgaccggccttgggggcagggaa
gacggccctttgcgccagtcccgttttgatatttccgtggccagcgaagttatggccata
cttgccctggcgagggatcttccggatctcagaaagcgcctggggcgcatggttgcagct
tgcaacaagaaaggcgatcccgtcaccgcagaggatctgggcgttgcaggggccatgacc
gtgctgatgaaggacgctctcaagccgaatttattgcagaccattgaaggccagggcagc
tttgtccacgccgggccttttgccaacattgcccacggtaattcttctataatagcggat
cttctggcggtgaattacgcggactttgtagttaccgaagccggattcggttccgacatg
gggatggagaaatttttcgacatcaagtgccgcacttcgggcctggtccctgatgcggta
gtcctggtggcaactgtgcgggccctcaagtcccatggaggcggcccggcggtagttccc
ggaaaacccctgcctcccgaatataaagaagaaaatttggaactcctcaaaaagggcctc
cccaacctgctggcccacataggcataatcagccgtttcggcgtgcctgcggtggttgcc
atcaacgccttccccacagataccgaggcggaatgggaattggtgcgcgacgcagccatc
aaggccggcgcagcagacgcggtggttaccacccactgggcaaatgggggcgagggagct
gcggatcttgcaagggcagtggagaaggctgcttcattgccaagccatttcaaactcctc
tatcctgatgaagtccctcttaagcaaaaaattgaaaccgtggctgtccgggtttacggc
gccgagggcgttgattttgagaagggcgttttaaaggaacttgatactctcgaagagaaa
ggttatgggaagcttcctgtgtgcatggccaagacacagtattcgctttctcacgatcct
gccctcaaaggggcgcccaggggctggaggcttccggttcgggaagttcgccttgctgca
ggcgctgggttcgtctatcccctctgcggggctattaccaccatgccggggctgccttca
aggcccgcctttatggatgttgatattgatgatgacggaaccgtgaggggccttttctag

DBGET integrated database retrieval system