KEGG   Treponema azotonutricium: TREAZ_1644Help
Entry
TREAZ_1644        CDS       T01506                                 

Definition
(GenBank) dihydropteroate synthase DhpS
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
taz  Treponema azotonutricium
Pathway
taz01100  Metabolic pathways
taz01120  Microbial metabolism in diverse environments
taz01200  Carbon metabolism
Brite
Enzymes [BR:taz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     TREAZ_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEF83447
UniProt: F5YDB3
Position
733929..734714
Genome map
AA seq 261 aa AA seqDB search
MGKFIVVGERIHCISPAIRAAMEKMDPAPIIQRAKDQIAGGASYLDVNIGPAEKNGEELM
KWAVKLIQENCDNIPLCLDTANKKAIEAGISVYNRTHGKPIVNSADAGDRISNIDLAAAN
DAIVITLCSKHGVPANNEERMTFCQEMLEHGLALGMDALDMWFDPLTLVIKGMQEKQPEY
LEFIRQLKDMGLNSTAGLSNASNGMPKELRPVVDSVLTAMAIECGLTSAIMNPCDKRLMD
TVKTCAVILNQTLYADSYLEL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagtttatcgttgtaggtgaaaggatacattgtatctctccggcgattcgtgct
gctatggaaaaaatggatcccgctccgattattcagcgggccaaggatcagatcgcgggc
ggcgcatcctatcttgatgtgaatatcgggcctgccgaaaagaacggcgaagagcttatg
aagtgggcggtaaaactgatacaggaaaactgcgacaacatccccctctgcctcgacacg
gccaacaagaaagccatcgaggcgggcatctcggtgtataaccgcacccacggtaagccc
attgtcaactctgccgacgcgggcgatcgcatttccaacatcgacctggcggccgccaac
gatgccatcgtcatcaccctctgttccaagcacggcgtccctgccaacaacgaggagcgc
atgaccttctgccaggaaatgctggaacatggtcttgccctgggcatggacgccctggac
atgtggttcgaccccctgaccctggtcatcaagggcatgcaggaaaagcagcctgaatac
ctcgagttcatacgtcagcttaaagatatgggcctcaattccacagctggcctttccaac
gccagcaacggcatgcccaaggaactgcgccctgtggtggactcagtcctcaccgccatg
gccattgaatgcggtctcacctccgccatcatgaacccctgcgacaagaggcttatggat
acggtgaaaacttgtgcggttattttgaaccagactttgtacgcggattcttatttggaa
ctgtaa

DBGET integrated database retrieval system