KEGG   Treponema azotonutricium: TREAZ_2048Help
Entry
TREAZ_2048        CDS       T01506                                 

Definition
(GenBank) phosphatidylserine decarboxylase-like protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
taz  Treponema azotonutricium
Pathway
taz00564  Glycerophospholipid metabolism
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
Module
taz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:taz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TREAZ_2048
Enzymes [BR:taz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     TREAZ_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_M23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEF83099
UniProt: F5YA15
Position
complement(321828..322469)
Genome map
AA seq 213 aa AA seqDB search
MTIAKEGFPFIFIPFIAGLAFILVPCLAGLGVLAVYICLGPGILLVIFSLFCLFFFRDPK
IRITEAPGAILSPCNGTVMEIVEKDDEKILRVFLSIFNVHLQRAPLSGTVRSVEHKDGKF
LAAWNPLAQSENKQNIITVDSEKGVFTVRQIAGFLARRCVSWVKAGDAVRAGDKIGLIKF
SSQVDLHLPKKAVISVRPEDKVRAGITIVGELK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagctaaagaagggtttcccttcatttttatcccttttattgccgggttggca
ttcattctcgtgccctgcctggcagggcttggggtattggcggtgtatatctgcctgggc
cccggcatactcctggtgattttttcgctcttttgcctcttcttcttcagggatcccaaa
atcaggataacagaggcgccgggcgctattctttcgccctgcaacgggacagtcatggag
atagtcgaaaaggatgatgaaaaaatcctcagggtgttcctttcaatctttaacgttcat
ctccaaagggcgcccctgagcggcacggtacgcagcgtggagcacaaggacggcaagttt
ttggccgcctggaaccccctggcccaatcggagaacaagcagaacattattacggtggat
agtgagaagggcgtttttacggtgaggcagattgcgggcttccttgcaaggcgctgcgtc
tcctgggtcaaggcgggggatgcggtaagggcaggggacaagatcggccttataaagttc
agctcccaggtggatcttcatctgcccaaaaaagcggtgatcagcgtcaggcccgaagac
aaggtgcgggccggcattacgatagtaggagaattaaaatga

DBGET integrated database retrieval system