KEGG   Treponema azotonutricium: TREAZ_2926Help
Entry
TREAZ_2926        CDS       T01506                                 

Definition
(GenBank) phenylacrylic acid decarboxylase (PAD)
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
taz  Treponema azotonutricium
Pathway
taz00130  Ubiquinone and other terpenoid-quinone biosynthesis
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01120  Microbial metabolism in diverse environments
taz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:taz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    TREAZ_2926
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TREAZ_2926
Enzymes [BR:taz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     TREAZ_2926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein MWFE Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: AEF82323
UniProt: F5YBU0
Position
3265018..3265587
Genome map
AA seq 189 aa AA seqDB search
MGKYLICITGASGSVYGIRTIKALVEGGHEVHSIVSSWGNRVMERETGKSLASWIGELGL
PPERVYAPEDLAAPPASGSFRLDGTVVVPCSMSSVGAIASGLCLNLIHRSALVSLKEGRP
LVLVPRETPLSLLDLRNLTVLAEAGAVILPASPAFYQVPQNIDDMVNFVAGKILDRLGID
HNLYTRWGT
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagtacctgatttgcatcaccggcgccagcgggtctgtctacggaatccgtacg
ataaaggcccttgtcgaaggcgggcatgaagttcacagcatcgtttcttcctgggggaac
cgggttatggaacgtgaaaccggaaaatcccttgcttcatggataggagaactggggctt
ccgccggaacgggtctatgccccggaggatctggcggcgcccccggccagcggttccttc
aggctcgatggaactgtggtggtcccctgctccatgagcagcgttggggcgattgcctca
gggttatgccttaacctgatacaccgttccgccctggtcagcctaaaagaagggcggccc
ctggtattggttccccgggaaacccccctgtccctgcttgacctccggaacctcaccgtc
ctggccgaagctggggcggtgatacttcctgcctccccggccttttatcaggttccccaa
aacattgatgatatggtaaattttgttgcgggaaaaattctcgacaggcttggcattgat
cataatctatatacacgttggggtacataa

DBGET integrated database retrieval system