KEGG   Treponema azotonutricium: TREAZ_2949Help
Entry
TREAZ_2949        CDS       T01506                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
taz  Treponema azotonutricium
Pathway
taz00260  Glycine, serine and threonine metabolism
taz00630  Glyoxylate and dicarboxylate metabolism
taz00670  One carbon pool by folate
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01130  Biosynthesis of antibiotics
taz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:taz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TREAZ_2949 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TREAZ_2949 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TREAZ_2949 (gcvT)
Enzymes [BR:taz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     TREAZ_2949 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AEF82614
UniProt: F5YBS0
Position
3239784..3240872
Genome map
AA seq 362 aa AA seqDB search
MEKKTPLYPWHESHGGRIVPFASYLLPVQYESGVIAEHNAVREKAGLFDVSHMGEFAIAG
KAALEALQKILTNDFTNMAIGRVRYSLMCNEQGCIIDDLVVCKMDEGRYMLVVNAANRDK
DAAWIKTKLKEIKLDGASFEDVSDKFAQIALQGPLAPAILSSLSNTIPEKYYTLIERGSV
AGIDCIVSRTGYTGETGFELYCKPDDAIALWEKIMQAGKNSGLIPCGLGARDTLRLEASM
PLYGHEMDETITPFEAGLASAVKMNKDFFIGKEGLTGKEKPGRIRTGLKIIDRGIARENC
PVSVNGKNVGKTTSGTFCPHLKAAMAMALLDTSIAAPGNIVDVDVRGRIIKAETCALPFS
LI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagaaaactcccttatatccatggcatgaatctcacggaggaaggatagtcccc
tttgcgagttatcttttgcccgtccagtatgaaagcggcgtcatagccgagcacaatgct
gtccgcgaaaaagccggcctcttcgatgtttcccatatgggtgaatttgccattgccggc
aaggctgccctcgaagccctgcagaaaatcctcaccaacgatttcacgaacatggccata
ggccgggtgcgctactccctgatgtgtaatgagcaaggctgcatcatcgacgatctggtg
gtctgcaagatggacgaaggccgctatatgctggtggtcaatgcggccaaccgcgacaag
gatgcggcctggattaaaaccaagcttaaagaaattaaattagacggcgcttccttcgaa
gatgtctccgacaagtttgcgcaaatcgccctgcaagggcctctggcgcctgccatactc
tcttccctatcaaacacaatccccgaaaaatattacacccttatcgaaaggggcagtgtt
gcgggcattgactgcattgtttcccgcacaggctacaccggcgaaacaggttttgagctc
tattgcaagcccgatgatgccattgcactttgggaaaaaatcatgcaagcaggaaaaaat
tccggcttgattccctgcggcctgggcgcgagggataccttgcggctcgaggcttccatg
cccctctatggccatgaaatggacgaaaccattactccctttgaagcagggcttgcttcg
gcagtaaaaatgaacaaagattttttcattggcaaggaagggctcacgggaaaagagaag
ccaggccgcatacgcacagggcttaaaataatagacagaggaatagcccgggaaaactgc
ccggtgtcggtcaatggcaaaaacgttggaaaaacaacatcagggactttctgcccccat
ctcaaggcggctatggccatggcccttttggatacgagtattgctgctcccggaaatatc
gtagatgtggatgtacggggcaggatcataaaagccgaaacctgcgccttgcctttttct
ttgatttaa

DBGET integrated database retrieval system