KEGG   Treponema azotonutricium: TREAZ_2990Help
Entry
TREAZ_2990        CDS       T01506                                 

Gene name
metA
Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
taz  Treponema azotonutricium
Pathway
taz00270  Cysteine and methionine metabolism
taz00920  Sulfur metabolism
taz01100  Metabolic pathways
taz01110  Biosynthesis of secondary metabolites
taz01130  Biosynthesis of antibiotics
taz01230  Biosynthesis of amino acids
Module
taz_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:taz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    TREAZ_2990 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TREAZ_2990 (metA)
Enzymes [BR:taz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     TREAZ_2990 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     TREAZ_2990 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AEF83122
UniProt: F5YB78
Position
3199046..3199966
Genome map
AA seq 306 aa AA seqDB search
MPIKIPRALPAYNALREERVFVMTEDRAEHQDIRPLKVGIVNLMPTTVDTEIQLLRLLGN
SPLQVDITFLRMGSHESKNAPPGHLDKFYISAKEVISLGMHFDGLIITGAPVETLPFEEV
DYWDELAAVIDYSVKSAWSTMHICWGAQAALYRHYGIPKQPLAKKLFGVFPHKINERHSP
LFRGFDDEFLAPQSRHTSCDRDALAARPELTIQSESVETGVFLATARDLREIYVTGHLEY
DSLTLDREYRRDLGQGKPIAIPRNYYPGDDASQAPVVRWRAHAHLFFSNWLNYVYQETPF
NLDDIK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaaaataccgcgggccctgcccgcctataacgccctcagggaagaacgggtt
ttcgttatgaccgaagaccgcgccgaacaccaggacattcgccccctcaaagtggggata
gtaaacctcatgcccaccaccgtggacacggagatccagcttctgcgccttttggggaat
tcgcctcttcaagtggacatcacctttctcagaatgggaagccacgaatccaaaaacgcg
cccccggggcacctcgataaattctacatcagcgccaaggaggtcatttccctgggcatg
cacttcgacggcctcatcatcacaggcgcgccggtggagaccctccccttcgaggaagtg
gactactgggacgagcttgcggcggtcatcgactattcggtgaagagcgcatggtcaacc
atgcacatctgctggggcgcccaggcagccctctaccgccattatggcatacccaagcag
cccctcgccaaaaaactgttcggcgtcttcccccacaagatcaacgagcgccattccccc
ctgttcaggggttttgacgatgagttccttgccccccagtccaggcacacaagctgcgac
cgcgatgccctggccgcgaggcccgagctgaccatacaatccgagtcagtcgaaaccggc
gtctttctagccaccgcccgggacctccgggagatctacgtaacaggccacctggagtac
gactccctcaccctggacagggaataccgccgcgaccttgggcagggcaagcccatcgcc
ataccgaggaattactaccccggcgacgacgcctcgcaggcgccggtagtccgctggcgg
gcccacgcccacctcttcttttccaactggctcaactatgtgtaccaggagacgcccttc
aacctggacgatataaaatag

DBGET integrated database retrieval system