KEGG   Thermococcus barophilus: TERMP_00654Help
Entry
TERMP_00654       CDS       T01377                                 

Definition
(GenBank) geranylgeranyl reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
tba  Thermococcus barophilus
Pathway
tba00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tba00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TERMP_00654
Enzymes [BR:tba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     TERMP_00654
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     TERMP_00654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl DAO FAD_binding_2 FAD_oxidored Pyr_redox_2 Trp_halogenase NAD_binding_8 HI0933_like GDI Thi4 GIDA 3HCDH_N SE ApbA
Motif
Other DBs
NCBI-ProteinID: ADT83631
UniProt: F0LKQ2
Position
complement(561868..563061)
Genome map
AA seq 397 aa AA seqDB search
MELHYDVVVVGAGIAGPILSRNLAKKGYSVLMIDKKAEIGTPKRCGEGLGIEAFKKYDIP
LDRRFINREIYGAAIYSPSGYRLEIRYDRVAGVILERKIFDKMLAYYAAKAGADVMAKTE
AVGLIRKEGKIAGVKAKHEGEPLEIYADVIVAADGVESRVARWAGINSFLPPHEIDSAYE
YEMIIENFEFDPDLIHLYFGNNIAPRGYVWIFPKDEDRANVGIGINGDNPKTAKYYLEKW
LKENNIKGTKILEVNVGGVPVGGFLKELVKDNVVVVGDAARQVNPMHGGGMAEAMEAATI
ASKWIDKALSEENLELLKGYTEEWWAGEGQKLLRILKVRQISEKLSDDELDAAVQALSGA
DAEKIAAGDYKEVFKALIKHPRILLKPKMLKLLKEAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcattatgatgttgtagtggttggagccggcattgcggggccaattctctca
aggaatttggctaaaaagggatacagtgttctcatgattgacaaaaaagccgaaattgga
acaccaaaaagatgtggagaaggcttaggaatagaggcatttaaaaagtatgacattccg
ttggataggcgttttataaatagggaaatttatggtgctgcaatatattccccgagcggc
tatagacttgaaatcaggtatgatagggttgcaggtgtaatcttggaaaggaaaatcttt
gacaagatgctggcatattatgcagccaaggctggagcagacgttatggcaaagacagag
gctgttggcttaataagaaaagaaggcaagatagctggagttaaggctaagcacgaaggc
gaacctttggagatttatgctgacgttattgtcgcggctgatggggtagaaagcagagtg
gcaagatgggctggaataaacagctttttaccacctcacgagattgattcagcctatgaa
tatgaaatgataatcgagaattttgagttcgatccagatttgattcacctctactttgga
aataacatcgccccaagaggctacgtatggatctttccaaaagatgaagatagggcaaat
gttggaattggaataaacggagataatcccaaaacagcaaaatactacctcgaaaagtgg
ctcaaagagaacaacataaagggaacaaagattctggaggttaacgtcggtggagttcct
gttggcggctttttgaaagaactcgttaaagacaacgttgtagttgtcggagatgcggca
agacaagtaaatccaatgcacggaggaggaatggcggaagccatggaagcggcaacaata
gcgagcaagtggatcgacaaagctttgagcgaagagaaccttgaacttctcaaaggttac
acagaagaatggtgggctggagaaggtcaaaaattgcttaggattctaaaggtcaggcag
ataagtgagaagctcagtgatgatgagcttgatgctgcagttcaggcattaagcggtgca
gatgctgaaaagatagctgctggagactacaaggaagttttcaaagcactgataaagcat
ccaaggattctactcaaaccaaagatgcttaaacttctgaaagaggcgctttaa

DBGET integrated database retrieval system