KEGG   Thermococcus barophilus: TERMP_00768Help
Entry
TERMP_00768       CDS       T01377                                 

Definition
(GenBank) acetyl-CoA synthetase (ADP-forming) beta chain
  KO
K22224  acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
tba  Thermococcus barophilus
Pathway
tba00010  Glycolysis / Gluconeogenesis
tba00620  Pyruvate metabolism
tba00640  Propanoate metabolism
tba01100  Metabolic pathways
tba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERMP_00768
   00620 Pyruvate metabolism
    TERMP_00768
   00640 Propanoate metabolism
    TERMP_00768
Enzymes [BR:tba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     TERMP_00768
Lipid biosynthesis proteins [BR:tba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TERMP_00768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 ATP-grasp_2 GARS_A ATP-grasp CPSase_L_D2 DUF5126 RimK
Motif
Other DBs
NCBI-ProteinID: ADT83745
UniProt: F0LL94
Position
674984..675682
Genome map
AA seq 232 aa AA seqDB search
MDRVSKAREIIEKAKAEGRPLVEPEAKEILKLYGIPTPDFKVARNEEEAVKFAREIGYPV
VMKIVSPQIIHKSDAGGVKINIKNDDEAREAFRTIMENAKRYKPDADLWGVIIYKMLPLG
KEVIVGMIRDPQFGPAVMFGLGGIFVEILKDVSFRVAPITKEEALEMIKEIKAYPILAGA
RGEKPVNIEALADIIVKVGELALELPEVKELDINPIFAYEDEAVAVDARMLL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggatagggtttcaaaagcaagggaaattatcgaaaaagccaaggctgagggcagacct
cttgtagaaccagaggctaaggagattctcaagctctacggcattccaaccccagatttc
aaggttgcaagaaatgaggaggaagccgttaagtttgcaagggagattggttatccagtt
gtcatgaagattgtctcaccacagatcatccacaagagcgatgccggcggtgttaagatt
aacatcaaaaacgatgatgaagcaagagaagccttcagaacaatcatggaaaatgcaaag
agatacaagccagatgcagatctttggggtgttataatctataagatgcttccactcgga
aaggaagttatcgttggtatgattagagacccacagtttggtccagctgtcatgtttggt
cttggtggtatcttcgttgagattcttaaggatgtcagctttagagttgctccaataaca
aaggaagaagcacttgaaatgattaaagaaatcaaggcttacccaattcttgccggtgca
agaggagaaaaaccagtaaacattgaggctttggcagacataattgttaaagttggtgaa
ttggccctcgagcttccagaagtcaaagagcttgacatcaacccaatctttgcttatgag
gatgaggcagttgcagttgacgcaagaatgctactttga

DBGET integrated database retrieval system