KEGG   Thermus brockianus: A0O31_01461Help
Entry
A0O31_01461       CDS       T04600                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tbc  Thermus brockianus
Pathway
tbc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tbc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A0O31_01461 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tbc03011]
    A0O31_01461 (rplV)
Ribosome [BR:tbc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A0O31_01461 (rplV)
  Bacteria
    A0O31_01461 (rplV)
  Archaea
    A0O31_01461 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF1173
Motif
Other DBs
NCBI-ProteinID: APD09573
UniProt: A0A1J0LVS2
Position
1334045..1334386
Genome map
AA seq 113 aa AA seqDB search
MEAKAIARYVRIAPRKVRLVVDLIRGKSLEEARAILRYTHKRGAYHVAKVLESAAANAVN
NHDMLEDRLYVKAAFVDEGPALKRVLPRARGRADIMKKKTSHITVILGEKHGK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagccattgcccgttacgtgcgcatcgcccccaggaaggtccggctcgtg
gtggacctgatccgggggaagagcctcgaggaggcccgcgccatcctgcgctacacccac
aagcggggggcctaccacgtggccaaggtgctggagtccgccgccgccaacgcggtgaac
aaccacgacatgctggaggatcggctttacgtgaaggcggccttcgtggacgaggggccc
gccttgaagcgggtgcttccccgggcccggggccgggcggacatcatgaagaagaagacc
agccacatcacggtgatcttgggggagaagcatgggaaataa

DBGET integrated database retrieval system