KEGG   Thermus brockianus: A0O31_02200Help
Entry
A0O31_02200       CDS       T04600                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
tbc  Thermus brockianus
Brite
KEGG Orthology (KO) [BR:tbc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0O31_02200
Enzymes [BR:tbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     A0O31_02200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: APD10244
UniProt: A0A1J0LW33
Position
complement(1979791..1980498)
Genome map
AA seq 235 aa AA seqDB search
MRLALAHLSKRDSPKELLKALHPLAREARAEGAGLLLLPELILGKREAPGLPQALEDLAG
EVGLRVAVGLLLEGQNRLQVFPQGPAYAKVHLYLTPEEEGDEGLRPGDGPVPLAHEGRAF
GLALCYDLDFPELFRAYALGGAQAFLVGAAWPGAYADLMEVLARARAAENQAYLFLASRA
DTGSPSLFVGPDGRVLGRREEEGLLLAEPDWGFLEAYRARYPLLRHRREGAYRLW
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgccctggcccacctttccaagcgggatagcccgaaggagctccttaaggcc
ctccaccccctggcccgggaggcgcgggccgagggggcggggcttttgctccttcccgag
ctcatcctgggcaagcgggaagcgcccgggctcccccaagccctcgaggacctggcgggg
gaggtgggcctaagggtggcggtaggcctcctcctagaagggcaaaaccgcctccaggtc
ttcccccaaggccccgcttacgccaaggtccacctctacctgacgccggaggaggagggg
gacgaggggctccgcccaggggatggtcccgtgcccctggcgcacgaggggcgcgccttc
ggcctcgccctctgctacgatctggacttccccgaactcttccgggcctacgccctcggg
ggcgcccaggcctttctggtgggggctgcctggcccggggcctacgccgacctcatggag
gtcctggcccgggcccgggcggcggagaaccaggcctacctcttcttggcgagccgggcg
gacacgggaagcccaagcctcttcgtgggccccgacggccgggtcctcgggcggagggag
gaggaaggcctcctcctcgccgagcccgattggggtttcctcgaggcctaccgggcccgc
tatcccctcctcaggcaccgccgggaaggggcctaccgcctctggtaa

DBGET integrated database retrieval system