KEGG   Thiobacillus denitrificans: Tbd_0805Help
Entry
Tbd_0805          CDS       T00275                                 

Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00020  Citrate cycle (TCA cycle)
tbd00640  Propanoate metabolism
tbd00660  C5-Branched dibasic acid metabolism
tbd01100  Metabolic pathways
tbd01110  Biosynthesis of secondary metabolites
tbd01120  Microbial metabolism in diverse environments
tbd01130  Biosynthesis of antibiotics
tbd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tbd_0805
   00640 Propanoate metabolism
    Tbd_0805
   00660 C5-Branched dibasic acid metabolism
    Tbd_0805
Enzymes [BR:tbd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tbd_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AAZ96758
UniProt: Q3SKM1
Position
846766..847926
Genome map
AA seq 386 aa AA seqDB search
MNLHEYQAKQVLRSSNLNTPRGIAATSADAAADAARELGGEAWVVKAQIHAGGRGKAGGV
KVVTSIDAVRSVAAALLGKPLVTVQNAPDGQPVHTVLVEETLPIARELYLSLLVDRASER
VAVVASAAGGMDIEQVAHATPEKVLTEICDPLLGVQDFQCRALAFALGLGGDAYKDFCRL
LPQLYRVFVANDLSLLEINPLVVTTDNRVLPLDCKMSVDDNALYRRKALADLRDDSQIDA
KEAAANAANVNYVALAGNIGCMVNGAGLAMATMDLIQLEGGAPANFLDVGGGATPETVAQ
GFKIILLDPNVKAVLINIFGGIVRCDVIAEGIIQAVREVGVEVPVIVRLEGTNAELGRTL
LAESGLAIVAAESLTQAAKFAVEKAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcacgaataccaggccaaacaagtcttgcggtcgagcaaccttaacacgccg
cgcggcatcgctgcgacgagcgccgacgccgcggccgacgccgcccgcgaactgggcggc
gaggcctgggtcgtgaaggcccagatccacgccggcgggcgcggcaaggccggcggcgtc
aaggtcgtgacgagcatcgacgcggtgcgcagcgtcgccgccgcgttgctcggcaagccg
ctcgtcaccgtgcagaacgcgcccgacggccagccggtccataccgtgctggtcgaggaa
acgctgccgatcgcacgcgaactgtatctttcgctgctggtcgaccgtgcctccgagcgc
gtcgcggtcgtcgcgtcggccgcgggcggcatggacatcgagcaggtcgcccatgccaca
cccgagaaagttctgaccgagatctgcgatccgctgctcggcgtgcaggatttccagtgc
cgcgcgctcgctttcgcgctcgggctcggcggcgacgcctacaaggatttctgccgcctg
ctgccgcagctctaccgtgtcttcgtcgccaatgatctgagcctgctcgagatcaatccg
ctcgtcgtcaccaccgacaaccgcgttctgccgctcgactgcaagatgagcgtcgacgac
aacgcgctctaccgcaggaaggcgctcgccgacctgcgcgacgacagccagatcgacgcc
aaggaagcggccgccaacgcggccaacgtcaactacgtcgcgctcgccggcaacatcggc
tgcatggtcaacggtgccggtctcgcgatggcgacgatggacctgatccagctcgaaggc
ggcgcgccggccaactttctcgacgtcggcggcggagcgacgcccgagaccgtcgcgcag
ggcttcaagatcatcctgctcgaccccaacgtgaaggccgtgctgatcaacatcttcggc
ggcatcgtgcgctgcgacgtgatcgccgagggcatcatccaggcggtcagggaagtcggc
gtcgaggttccggtcatcgtgcgcctcgagggcacgaatgccgaactcggccgcaccctg
ctggccgaatcgggcctcgcgatcgtcgcggccgagagcctgacccaggccgcgaaattc
gccgtggagaaagcggcatga

DBGET integrated database retrieval system