KEGG   Thiobacillus denitrificans: Tbd_0836Help
Entry
Tbd_0836          CDS       T00275                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tbd  Thiobacillus denitrificans
Brite
Enzymes [BR:tbd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tbd_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 Methyltransf_11 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: AAZ96789
UniProt: Q3SKJ2
Position
886713..887393
Genome map
AA seq 226 aa AA seqDB search
MAETLNPRAGIGMTSARTRGRMVERLREQGIKDEMVLAAMGMVPRHLYVDQALESRAYED
TALPIGFGQTISNPYIVARMAELARHGENGKGQTLGRVLEIGLGCGYQAAVLGKLAREVV
SIERIAALVGKTRARLRELRVNNVKPKHGDGMNGARDFAPFDAIVLAAAFAEVPQALLAQ
LADGGRLVMPLGNATQTLCLIERQGEAFVEQRLEGVKFVPLLPGVA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaaccctgaacccgcgcgccggcatcggcatgacctcggcgcggacccgcggc
cgcatggtcgagcgtctgcgcgagcagggcatcaaggacgaaatggtgctggcggcgatg
ggcatggtcccgcgtcacctctacgtcgaccaggcgctcgagtcgcgcgcctacgaggac
acggccctgccgatcggcttcggccagaccatatccaatccctacatcgtcgcgcgcatg
gccgagctcgcccgccacggcgaaaacggcaaggggcagacgctcggccgcgtgctcgag
atcggcctcggctgcggctaccaggccgcggtgctcggcaagcttgcgcgcgaggtggtg
tcgatcgagcgcatcgctgcgctcgtcggcaagacgcgcgcccgcctgcgcgaactgcgc
gtcaacaacgtcaagccgaagcacggcgacggcatgaacggcgcccgggatttcgcgccc
ttcgatgccatcgtgctcgcggcggccttcgccgaggtcccgcaggccttgcttgcgcag
ctggccgatggcggccgcctggtgatgccgctcggcaacgccacccagacgctgtgcctg
atcgagcgtcaaggcgaagccttcgtcgaacagcgcctcgaaggggtgaaattcgtgccg
ctgctgccgggggtcgcgtga

DBGET integrated database retrieval system