KEGG   Thiobacillus denitrificans: Tbd_0860Help
Entry
Tbd_0860          CDS       T00275                                 

Definition
(GenBank) methionyl-tRNA synthetase, class Ia
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00450  Selenocompound metabolism
tbd00970  Aminoacyl-tRNA biosynthesis
tbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Tbd_0860
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tbd_0860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbd01007]
    Tbd_0860
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbd03016]
    Tbd_0860
Enzymes [BR:tbd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Tbd_0860
Amino acid related enzymes [BR:tbd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Tbd_0860
Transfer RNA biogenesis [BR:tbd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tbd_0860
 Prokaryotic type
   Other AARSs
    Tbd_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AAZ96813
UniProt: Q3SKG8
Position
complement(910688..912760)
Genome map
AA seq 690 aa AA seqDB search
MSRQILVTSALPYANGSIHLGHLVEYIQTDIWVRFQKMRGTNCRYMCADDTHGTAIMLRA
EKEAITPEALIQRVWAEHTRDFAGFHIGFDHYYSTHSDENREHASKIYLALKDAGLIEVK
TIAQLYDPVKNLFLPDRFIKGECPKCGAADQYGDNCEVCGATYSPTELKNPVSAVSGATP
VHKDSEHYFFKLGDCEAFLREWTTSGTLQAEAANKMQEWFAAGLNNWDISRDAPYFGFEI
PDAPGKYFYVWLDAPVGYMASFARYAKDHGLDFDAWWGKDSKTELVHFIGKDILYFHALF
WPAMLKFSGHRLPTAVYAHGFLTVNGQKMSKSRGTFITASSYLDQGLNPEWLRYYYAAKL
NGTMEDIDLNLDDFVARVNSDLVGKFINIASRTAGFIHKKFDGKLADGVGNIELIGEFQA
AADTIAAHYEARDYAKALREIMALADRANQYVADEKPWELAKDDAAVYRLHEVCTVALNL
FRLLTLYLKPVLPKLAGEVERFLDIPALTWKDARSLFIRQAINAYSHLMTRIDPKSIEAM
VDANKQNLEPTPAPAPARHAEAQAHAAQAVEAPKTETISIDDFAKVDLRIARIANAEHVE
GADKLLRLTLDVGELGPRQVFAGIKSAYAPEALVGRLTVMVANLAPRKMKFGMSEGMVLA
ASNPDGHKDDVPGLFILSPDSGAEPGMKVK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcaaatcctcgtcacctctgcgctgccctacgccaacggcagcattcatctg
ggtcatctggtcgagtacatccagaccgacatttgggtgcgtttccagaaaatgcggggc
accaactgccgctacatgtgcgccgacgacacgcacggcaccgcgatcatgctgcgcgcc
gagaaggaagccatcacacccgaggcgctgatccagcgcgtgtgggccgaacacacgcgc
gatttcgcgggcttccacatcggcttcgatcactattactcgacgcactcggacgagaac
cgcgaacacgcatcgaagatctacctggccttgaaggacgccgggctgatcgaggtgaag
acgatcgcgcagctgtacgacccggtgaagaacctcttcctgcccgaccgcttcatcaag
ggcgaatgcccgaagtgcggcgcggcggaccagtacggcgacaactgcgaggtctgcggc
gcgacctacagcccgaccgagctcaagaaccccgtctcggcggtgtcgggcgcgacgccg
gtgcacaaggattccgagcactacttcttcaagctcggcgactgcgaggcctttctgcgc
gagtggaccacctcagggacgctgcaggccgaggccgctaacaagatgcaggagtggttc
gcggcgggactcaacaactgggacatcagccgcgacgcgccctacttcggcttcgagatc
cccgacgcgccgggcaagtatttctacgtctggctcgacgcgccggtcggctacatggcg
agcttcgccagatatgcgaaggaccacggcctcgacttcgacgcctggtggggcaaggat
tcgaagaccgaactcgtgcacttcatcggcaaagacatcctgtatttccacgccttgttc
tggccggcgatgctcaagttctccggccaccgcctgccgaccgccgtctacgcgcacggc
ttcctgaccgtcaacggccagaagatgtcgaagtcgcgcggcaccttcatcaccgcgtcg
agctatctcgaccaaggcctcaaccccgagtggctgcgctactactacgctgcgaagctc
aacggcacgatggaggacatcgatctcaacctcgacgacttcgtcgcgcgcgtgaactcg
gacctcgtcggcaagttcatcaatatcgcgagccgcacggccggcttcatccacaagaag
ttcgacggcaagctcgccgacggcgtcggcaacattgaactaatcggcgaattccaggcc
gcggccgacacgatcgccgcgcactacgaggcgcgcgactacgccaaggcgctcagggag
atcatggcgctcgccgaccgcgcgaaccagtatgttgccgacgaaaagccgtgggaactg
gccaaggacgacgcagcggtctaccgcctgcacgaggtctgcacggtcgcgctcaacctg
ttccgcctgctcacgctttacctcaagcccgtgttgcccaagctcgccggcgaagtcgag
cgcttcctcgacatccccgccctcacgtggaaagacgcgcgaagtcttttcatccgccag
gccatcaacgcatacagccatctcatgacccgcatcgatcccaaatccatcgaagccatg
gtagacgccaacaagcagaacctcgaacccactcccgccccggcccccgcccgccacgcc
gaggcgcaggcgcatgccgcgcaggccgtcgaagcaccgaagaccgagacgatctcgatc
gacgacttcgcgaaggtcgacctgcgcatcgcgcgcatcgccaacgcggagcacgtcgaa
ggcgccgacaagctgctgcgcttgacgctcgacgtcggtgaactcggcccccgccaggta
ttcgccggcatcaagtcggcctacgcgcccgaagcgctggtcggccggctgaccgtcatg
gtcgccaacctcgcgccgcgcaagatgaagttcggcatgagcgagggcatggtgctcgcc
gcctccaaccccgacgggcataaagacgacgtgcccggcctcttcatcctctcgcccgac
agcggcgccgagccgggcatgaaggtcaagtaa

DBGET integrated database retrieval system