KEGG   Thiobacillus denitrificans: Tbd_1173Help
Entry
Tbd_1173          CDS       T00275                                 

Definition
(GenBank) alpha amylase, catalytic subdomain
  KO
K01236  maltooligosyltrehalose trehalohydrolase [EC:3.2.1.141]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00500  Starch and sucrose metabolism
tbd01100  Metabolic pathways
tbd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tbd_1173
Enzymes [BR:tbd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.141  4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase
     Tbd_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 CBM_48 Tox-HNH-HHH hDGE_amylase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAZ97126
UniProt: Q3SJM8
Position
1227318..1229096
Genome map
AA seq 592 aa AA seqDB search
MPFGTRITPEGVRFRLWAPGCERVMLHIEEGAAVGRMMMPSGDGWFELLVDGAGAGTPYR
FEVNDGLRVPDPASRFNPDDVHGASVVVDPTAFAWRDTAWKGRPWEEAVVYELHVGTFSP
SGTFAGVIERLDYLVDLGVTAIELMPVADFPGVHNWGYDGVLLFAPDSRYGTPDDLKALV
QSAHDKGLMVLLDVVYNHFGPEGNYLHVYARKFFSERHHTLWGAAINFDGSGSRTVRDFF
IHNALYWLQEYHFDGLRLDAVHAIIDDSARHILTELAERVHAEIGSERAVHLILENDANE
AHHLGQGGYTAQWNDDIHHALHVLATGEADGYYGDYADAPLVHLGRCLTEGFAYQGQASA
YHEGESRGEPSGHLPLQAFVAFVQNHDQVGNRAFGERLTQLAPESALRAVAAVLLLAPSV
PMLFMGEEFGARTPFQFFCDFGGELRDAVTQGRRREFRKFARFADPAAQAAIPDPNRPET
FLASRLDWSEAGAGALDQYRGLLKLRRETIVPRLRLIEPGSAAFEVVAGVLRVRWGLHDG
ASLQLTAHLSQEPLGEVALEGEVIFATSDAAAAGVLGPWSVVWTLAAAETQA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcggcacccggatcacgcccgagggcgtgcgatttcgcctgtgggcgccggga
tgcgagcgggtgatgctgcacatcgaggagggggcggcagtggggcggatgatgatgccg
agcggcgacggctggttcgagctcctagtcgatggggcaggtgcgggaacgccttatcgc
ttcgaggtgaacgacggcctgcgcgtccccgacccggcctcgcgtttcaatcccgacgac
gtgcacggagcgagcgtcgtcgtcgacccgaccgccttcgcctggcgtgacacggcgtgg
aaggggcggccctgggaagaagcagtcgtgtacgaactgcacgtcgggaccttctcgccg
tctggcaccttcgccggcgtgatcgagcggctcgactacctcgtcgacctcggtgtcacg
gcgatcgagctgatgccggtcgcggactttccgggtgtgcacaactggggttacgacggc
gtcctgctgtttgcgccggacagccgctacggcacgcccgacgacctcaaggcgctcgtc
cagtccgcgcacgacaaggggctgatggtgttgctcgacgtcgtctacaaccatttcggc
cccgaggggaattacctgcatgtgtacgcgcgcaagttcttcagcgagcgccaccacacg
ctgtggggcgccgcgatcaacttcgacggctccggcagccgtaccgtgcgtgatttcttc
atccacaacgcgctctactggctgcaggaataccacttcgacggcctgcgcctcgacgcg
gtgcacgcgatcatcgacgattcggcgcgccacatcctcaccgagcttgccgagcgcgtg
cacgcagagatcggcagcgagcgtgccgtgcatctgatcctcgagaacgatgccaacgaa
gcgcaccaccttggacaaggtggctacacggcgcaatggaacgacgacatccatcacgcg
ctgcacgtgctcgcgaccggggaagccgacggctattacggcgactacgccgatgcgccg
ctcgtccacctcggccgctgcctgaccgagggcttcgcctaccagggccaggcgtcggcc
taccacgagggcgaatcgcggggcgagccgagcggccatctcccgctgcaggctttcgtc
gccttcgtgcaaaaccacgatcaggtggggaaccgcgccttcggcgagcgcctgacgcaa
ctcgctccggaatccgcgctgcgcgcggtcgccgccgtcctgctgctcgcgccgtcggtg
cccatgctgttcatgggcgaggagttcggcgcgcggacgccgttccagttcttctgcgac
ttcggcggcgaactgcgggacgcggtgacgcagggacggcggcgggagttccgcaagttc
gcgcgctttgccgaccccgccgcgcaagccgcgatacccgacccgaaccggcccgagacg
tttctcgcgtcgcggctcgactggtcggaggcgggcgccggcgcgctcgaccaataccgc
ggcctgctgaagctgaggcgtgaaacgatcgtcccgcgcctgcgcctgatcgagcccggc
tcggccgcattcgaggtcgtcgcgggcgtcctgcgcgtgcgctggggcttgcacgacggc
gcctccctgcaactcacggcccatctgtcgcaagagccgctcggcgaggtcgcgctcgaa
ggcgaggtcattttcgccacctccgatgcggcggcggccggcgttctcggtccctggtcg
gtcgtatggacgctcgcggccgcggagacccaggcatga

DBGET integrated database retrieval system