KEGG   Thiobacillus denitrificans: Tbd_1183Help
Entry
Tbd_1183          CDS       T00275                                 

Definition
(GenBank) succinate dehydrogenase, cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00020  Citrate cycle (TCA cycle)
tbd00190  Oxidative phosphorylation
tbd00650  Butanoate metabolism
tbd01100  Metabolic pathways
tbd01110  Biosynthesis of secondary metabolites
tbd01120  Microbial metabolism in diverse environments
tbd01130  Biosynthesis of antibiotics
tbd01200  Carbon metabolism
Module
tbd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tbd_1183
   00650 Butanoate metabolism
    Tbd_1183
  Energy metabolism
   00190 Oxidative phosphorylation
    Tbd_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF4987
Motif
Other DBs
NCBI-ProteinID: AAZ97136
UniProt: Q3SJL8
Position
1242729..1243088
Genome map
AA seq 119 aa AA seqDB search
MKAATGSHTGTGTWLVQRATAVVLALALPLLLLRFLAAPPLDFAAWQALLAPLWLRLLML
LAAGALALHAWVGVRDILMDYVHATGLRLTIYMAVIGTLATSVAWLAAILFGPVFGRAA
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcgaccggctcgcacacggggaccggaacctggctcgtgcagcgcgcgacg
gcggtcgtgctcgcgctggccctgccgctcctgctgctgcgctttctcgccgcgccgccg
ctcgacttcgccgcctggcaggcgctgctcgcgccgctctggctgcgtctgctgatgctg
ctcgcggccggcgcgctggcccttcacgcctgggtcggcgtgcgcgacatcctgatggat
tacgtccatgcgaccggactgcgcctgacgatatatatggccgtgatcggcaccctggcg
acgagtgtcgcgtggctcgccgcgatcctgttcggcccggtcttcgggcgcgcggcgtga

DBGET integrated database retrieval system