KEGG   Thiobacillus denitrificans: Tbd_1483
Entry
Tbd_1483          CDS       T00275                                 

Definition
(GenBank) peptidase S24, LexA repressor
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
tbd  Thiobacillus denitrificans
Brite
KEGG Orthology (KO) [BR:tbd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tbd01002]
    Tbd_1483
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tbd03400]
    Tbd_1483
Enzymes [BR:tbd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     Tbd_1483
Peptidases and inhibitors [BR:tbd01002]
 Serine peptidases
  Family S24: LexA family
   Tbd_1483
DNA repair and recombination proteins [BR:tbd03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Tbd_1483
SSDB
Motif
Pfam: Peptidase_S24 LexA_DNA_bind FaeA HTH_20 Sigma70_r4 Rrf2 HTH_Crp_2 YIEGIA
Other DBs
NCBI-ProteinID: AAZ97436
UniProt: Q3SIT9
Position
complement(1570775..1571560)
AA seq 261 aa
MPRCFMRLKARGLIFPSFIMRVSCDARQPGHRALAFFGLGTYTVRTYSNVLYMHTVSGGS
PMRDLTPRQEEILNLIREWIDTTGSPPTRAEIAQHFGFSSPNAAEQHLKTLAKKGALELV
SGASRGIRLPGGGGLAVVGQVAAGSPILAQENIERHVQVDTALFSPRADYLLKVRGQSMK
DIGILDGDLLAVHRSAEARAGQVVVARIGDEVTVKRFQKRGHTVQLLPENADFEPIVVDL
KRQELVIEGIAVGVIRSGRSL
NT seq 786 nt   +upstreamnt  +downstreamnt
atgccgcgctgcttcatgcggctgaaggcgagggggctgatctttccgagtttcatcatg
cgggtctcctgcgatgcacggcagccgggccaccgtgccttggcgtttttcgggttgggt
acttatactgtacggacatacagtaacgtactgtacatgcatacagtatccggaggaagc
cccatgcgagacctgaccccgcgccaggaagaaatcctgaacctcatccgcgagtggatc
gacaccaccggctcgccgccgacgcgcgccgagatcgcgcagcacttcggcttcagttcg
ccgaacgcggccgagcagcatctcaagacgctggcgaagaagggcgcgctggaactcgtg
tcgggggcctcgcgcggcatccgcctgccgggcggcggcggccttgcggtcgtcggccag
gtcgcggcgggcagtccgatcctcgcgcaggaaaacatcgagcggcatgtccaggtcgac
accgcgctgttcagcccgcgcgcggactacctgctcaaggtgcgcggtcagagcatgaag
gacatcggcatcctcgacggcgacctgctcgccgtgcaccgcagcgccgaggcgcgggcc
gggcaggtcgtcgtcgcacgcatcggtgatgaggtcacggtcaagcgcttccagaaacgc
ggccataccgtgcagctcctgcccgagaacgccgacttcgaaccgatcgtcgtcgacctc
aagcgccaggagctcgtcatcgagggtatcgcggtcggcgtgatccgcagcggcaggagc
ctctaa

DBGET integrated database retrieval system