KEGG   Thiobacillus denitrificans: Tbd_1778Help
Entry
Tbd_1778          CDS       T00275                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00521  Streptomycin biosynthesis
tbd00523  Polyketide sugar unit biosynthesis
tbd01130  Biosynthesis of antibiotics
Module
tbd_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Tbd_1778
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tbd_1778
Enzymes [BR:tbd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Tbd_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AAZ97731
UniProt: Q3SI02
Position
complement(1877813..1878355)
Genome map
AA seq 180 aa AA seqDB search
MNVVKTSLPEVLLLEPKVFGDARGFFLESWNRKTFSALGLDVDFVQDNHSRSARGVLRGL
HYQIKDPQGKLVRVVNGSVFDVAVDLRRASPNFGRWVGYELSAENQRMLWIPPGFAHGFL
VLSESADFLYKTTAYYAPEWDRGVCWNDPEIGIEWPWSGSPTLSAKDQVLPFLKDAEVYA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgtcaagacctcgcttccggaagtcctcttgctcgagcccaaggtcttcggc
gacgcccgtggcttctttctcgagagctggaatcgcaagacgttttccgcgctgggcctg
gacgtcgacttcgtgcaggacaaccattcgcggtcggcgcgcggcgtgctgcgcggcctg
cattaccagatcaaggatccgcagggcaagctcgtgcgtgtcgtgaacggctcggttttc
gacgtcgcggtcgatctgaggcgcgcgtcgccgaatttcggccgctgggtgggttacgag
ctgtcggccgaaaatcagagaatgctgtggattccgcccggcttcgcccatggctttctg
gtgttgtccgagagcgcagactttctttacaagacgaccgcgtattacgcgcctgagtgg
gaccggggcgtgtgctggaacgatcccgaaatcggcatcgagtggccatggagcggctcg
ccgaccctctcggccaaggaccaggtcttgccctttctcaaggacgccgaggtctacgcg
tga

DBGET integrated database retrieval system