KEGG   Thiobacillus denitrificans: Tbd_2062Help
Entry
Tbd_2062          CDS       T00275                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00010  Glycolysis / Gluconeogenesis
tbd00052  Galactose metabolism
tbd00500  Starch and sucrose metabolism
tbd00520  Amino sugar and nucleotide sugar metabolism
tbd00521  Streptomycin biosynthesis
tbd01100  Metabolic pathways
tbd01110  Biosynthesis of secondary metabolites
tbd01120  Microbial metabolism in diverse environments
tbd01130  Biosynthesis of antibiotics
tbd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbd_2062
   00052 Galactose metabolism
    Tbd_2062
   00500 Starch and sucrose metabolism
    Tbd_2062
   00520 Amino sugar and nucleotide sugar metabolism
    Tbd_2062
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tbd_2062
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tbd_2062
Enzymes [BR:tbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tbd_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AAZ98015
UniProt: Q3SH74
Position
complement(2153350..2154348)
Genome map
AA seq 332 aa AA seqDB search
MEWIAGDIGGTKSWLVWIGPPGDGLHPRFERVYPSADFVSAEALLRQFLADSGIQGRPDG
LILAVAGPSQAEHVKLTNLDWWIDAAELQLALGIPQVHIVNDFEAAAAGLATLVPADYVE
INPGQPDPLGVRAITGAGTGLGLAFLVHDPAGRETSYPTEGGHVDFAPANAMQDRLLKRL
RKQYGHVSWERVVSGSAMSELYAFCCVELGTTPCSASCDGACLVAAAAADDIAAEAALDL
FVDLYGAWVGNVALLYRPRGGLYIAGGVSAHLQKRIAAPRFMAAALDKGRMRRVVESTPI
FLITSPRLGVQGALALREAAAHSRRDRRTHER
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggagtggatcgcaggcgacatcggaggaacgaagagctggctcgtgtggatcgggccg
cctggcgacggcctgcacccgcgcttcgagcgcgtctacccgagcgccgacttcgtctcg
gccgaagccctgctgcggcagtttctcgccgactcggggatacagggacggcccgacggc
ctgatcctggccgtcgccggcccgtcgcaggccgagcacgtcaagctcaccaacctcgac
tggtggatcgacgcggccgagctccagctcgcgctcggcattccccaggtccacatcgtc
aacgatttcgaggctgccgccgcgggactcgcgaccctggtgccggccgactacgtcgag
atcaacccggggcagcccgacccgctcggcgtgcgcgcgatcacgggcgccgggaccggg
ctcggcctggccttcctcgtccatgacccggcagggcgggaaacgagctacccgaccgaa
ggcggccacgtcgactttgcgcccgccaacgccatgcaggatcggctgctgaagcgactg
cgcaagcaatacggtcacgtctcctgggagcgcgtcgtctccgggtcggcgatgtccgag
ctctatgcattctgctgcgtcgaacttggcaccacgccgtgctcggcgtcgtgcgacggc
gcctgcctcgtcgctgcggcggcggcggacgacatcgcggccgaggctgcgctcgatctc
tttgtcgacctctacggcgcctgggtcggcaacgtcgccttgctctaccgtccgcgcggc
gggctctacatcgccggcggcgtcagcgcgcacctgcagaagcgcatcgcggcgccgcgc
ttcatggccgcggcgctcgacaaggggcgcatgcgtcgcgtcgtcgaaagcacaccgata
tttctgatcacgagcccgcggctcggcgtgcagggcgcgctggccctgcgcgaagccgcg
gcgcacagccggcgcgaccgccggacccatgaacgataa

DBGET integrated database retrieval system