KEGG   Thiobacillus denitrificans: Tbd_2567Help
Entry
Tbd_2567          CDS       T00275                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tbd  Thiobacillus denitrificans
Pathway
tbd00860  Porphyrin and chlorophyll metabolism
tbd01100  Metabolic pathways
tbd01110  Biosynthesis of secondary metabolites
tbd01120  Microbial metabolism in diverse environments
Module
tbd_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tbd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tbd_2567
Enzymes [BR:tbd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tbd_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAZ98520
UniProt: Q3SFT6
Position
complement(2641432..2642190)
Genome map
AA seq 252 aa AA seqDB search
MTQPLAGRTILVTRAPRQAAALSAAIRAAGGSAFEFPALAFEAVPVDRLQASLAQVVAAD
FVIFVSPNAAEFGMAAIGSLAAGRSVLAVGPGTARALAAQGLDAVITPDGQDSEALLALP
QLLDVDGKRVVIVRGIGGRALLGDTLAARGAEVHYMECYRRLAPTADAAPLIARWQAGGI
DAVTVASAETLHNLAALLGEAGAPLLAHTPLFAPYEKIAAAARSFGVAQATATPGGDAGL
VAGLVNWFRNTA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcccctggccgggcgcacgatcctcgtcacccgcgcgccgcgccaggcggcc
gccttgagcgcggcgatccgcgcggccggcggcagcgcgttcgagttccccgcgctcgcc
ttcgaagccgtgccggtcgaccgcttgcaagcgtcgctcgcgcaggtcgtcgccgccgat
ttcgtgattttcgtcagcccgaatgcggcggaattcggcatggccgcgatcggcagcttg
gccgccgggcgcagcgtcctcgccgtcggtccgggaaccgcgcgcgccctcgcggcccaa
gggctcgatgccgtgatcacgcccgacggccaggacagcgaggccttgctcgcgctcccg
cagttgctcgacgtcgacggcaaacgcgtcgtcatcgtgcgcggcatcggcgggcgcgcg
ctcctgggcgacacgctcgccgcgcgcggcgccgaggtccattacatggagtgctaccgg
cgcctagcgccgacggccgatgcggcgccgctgatcgcgcgctggcaagccggcgggatc
gacgccgtcaccgtggcgagcgccgagacgctgcacaatctggccgcgctgcttggcgag
gccggggcgccgctgcttgcacatacgccgcttttcgcgccgtatgagaaaatcgccgcc
gctgcgcgcagcttcggtgtcgcccaggccacggcaacgcccggcggcgacgccggactc
gtcgcgggtctcgtcaactggttcaggaataccgcatga

DBGET integrated database retrieval system