KEGG   Treponema brennaborense: Trebr_1182Help
Entry
Trebr_1182        CDS       T01489                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
tbe  Treponema brennaborense
Pathway
tbe00010  Glycolysis / Gluconeogenesis
tbe00052  Galactose metabolism
tbe01100  Metabolic pathways
tbe01110  Biosynthesis of secondary metabolites
tbe01120  Microbial metabolism in diverse environments
tbe01130  Biosynthesis of antibiotics
Module
tbe_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trebr_1182
   00052 Galactose metabolism
    Trebr_1182
Enzymes [BR:tbe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Trebr_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEE16610
UniProt: F4LL13
Position
1403106..1404149
Genome map
AA seq 347 aa AA seqDB search
MKINKRKYGLLSDGTKAYLYTIDNGGMSFSVTNYGCVVTSIVLPSKSGRKDDIILGPATF
GGLVDSTACYGSFVGRFANRISGARFSLDGTEYVLDKNDGENCLHGGYFRWDKQIWDSEI
VETATGSGVRFTRTSPDGEQGMPGTMQVEVTYLLNEHDELVMHYDAVCDKSTPVNFTNHS
YFNLKGQGAGNIGNHVFTINCDSYLEADEHRIPSGKILPVEGTVFDFRAGKAIGPGLETG
DFNGAAGYDHCYCIERKKGKLQKFASVYEPDSGRTMTVSTDQPGVQLYTANWIEGDQGKN
GMYYRNHGGFCLETQQYPDAPNKPEFPCCILKAGEKYGTTTIYGFSW
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaataaaagaaaatacggtcttctttccgacggaacaaaagcttatttatat
actatagacaacggcggcatgtccttttccgtgacgaattacggatgcgttgttaccagt
atcgttcttccctccaaatcgggaagaaaagacgatatcattctgggaccggcgacgttc
ggcggcttggtcgattctacggcctgttacggttcgttcgtcggccgttttgcaaaccgt
atttccggcgcccgcttttcgctcgacggtaccgaatacgtgctcgataaaaacgacgga
gaaaattgtctgcacggcggctatttccgctgggataaacagatctgggacagtgaaatc
gtcgaaacggcgaccggctccggcgtccgttttacgcgtaccagtcccgacggcgagcag
ggaatgcccggcacgatgcaggtggaagtaacgtatttgctgaacgaacacgacgagttg
gtcatgcattacgatgcggtctgtgataaatccactccggttaattttaccaatcacagt
tatttcaatttgaaagggcagggggccggaaatatcggcaatcacgtgtttacgataaat
tgcgattcctatctggaagcggacgagcatcggattcccagcggaaagattcttccggtg
gaaggaaccgtgttcgatttccgtgccgggaaggccatcggtccgggcttggaaacgggc
gacttcaacggcgccgccggctacgaccactgctactgcatagaacgcaaaaaaggcaaa
ctgcaaaagttcgcttcggtttacgaaccggattccggaaggacgatgaccgtctctacc
gaccagccgggcgtgcagctgtatacggcgaattggatagaaggcgatcagggcaaaaac
ggtatgtactatcggaaccacggcgggttttgtcttgaaacgcagcagtatcccgacgcc
ccgaacaaacccgaatttccctgctgcattctcaaagccggtgaaaaatacggtacgacg
acgatatacggtttctcctggtag

DBGET integrated database retrieval system