KEGG   Treponema brennaborense: Trebr_1687Help
Entry
Trebr_1687        CDS       T01489                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tbe  Treponema brennaborense
Pathway
tbe00620  Pyruvate metabolism
tbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Trebr_1687
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tbe02000]
    Trebr_1687
Enzymes [BR:tbe01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Trebr_1687
Transporters [BR:tbe02000]
 Other transporters
  Primary active transporters [TC:3]
   Trebr_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 DUF2118 Peptidase_M23 GCV_H ALAD His_biosynth ADH_zinc_N Myco_19_kDa
Motif
Other DBs
NCBI-ProteinID: AEE17109
UniProt: F4LQ31
Position
complement(1990291..1992357)
Genome map
AA seq 688 aa AA seqDB search
MANKVKISDLVLRDAHQSLHATRMTTADMLPICEKLDKIGYWSLEGWGGATFDSCIRFLN
EDPWERLRKLHKALPNTPIMMLLRGQNLLGYRHYADDVVDKFVEAAARNGIGVFRIFDAC
NDPRNLKRATDAAKKTGKHVQMAISYATTPYHTKEIYADLAKSYADFGADSICIKDMSGL
LKPYEAYDLVKAIKAKVDLPVEIHTHATTGLSVATLLKAAEAGADILDTAISSMSMGTSH
SPTETVVEMLKGTELDTGLDLNTLLEIAAYFRDVRKKYAKFESSFLGADTRILASQVPGG
MLSNLENQLKEQGASDKIDDVLKEIQIVQKDCGYIPLVTPTSQIVGTQAVFNVLFGRYAK
LTQETRDLVTGKYGKTPAAVNADLLKEALKQNNMDAPVTCRPADLIPMEWDKMVEESKTN
GGDGSEEDTLTYAMFPKVAPKFFKERANGPVKSESFAVKPAASAASSNGGSYTVNVNGTS
YNVTAGPAGDAMSVTVNGTAYNVAFSAAAAASAAPAAAVSGGATITAPVAGTLLKHVVPA
GSMVKKGDTVIMVESMKMELEVKATVDGPITYAVQPGSQIAAGQVIANIGGGAPVAAPVQ
AAPAAAPAAPAPAAAPSGTGAVIAAPVAGTLLKNVVAEGSAVKSGDTIIMIESMKMELEV
KAASNGTVHFLASAGSQISAGQPLAEIK
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaaagttaaaatttctgatttggtactgcgcgatgcgcatcagtcgcttcac
gcgacgcgcatgacgactgccgatatgcttccgatttgcgaaaaactcgataaaatcggt
tattggagtttggaaggatggggcggcgctacgttcgattcctgcatccgctttttgaat
gaagatccgtgggaacgcctgcgcaaactgcacaaagcgctgcccaatacgccgatcatg
atgctgctgcgcggacagaacctgctcggttaccgccattacgcggatgacgtcgttgat
aaattcgtcgaagcggccgcccgcaacggtatcggcgtattccgcattttcgatgcgtgc
aacgatccgcgcaacctgaagcgtgcaaccgacgctgcaaaaaaaacgggcaaacacgta
caaatggcgatttcatacgcgaccactccgtaccacacgaaagaaatctacgccgacctg
gctaagtcctatgcggatttcggtgcggattcgatctgcatcaaagatatgtccggtctg
ctcaaaccgtacgaagcgtacgatttggtaaaggcgatcaaagcgaaagtcgatctgccc
gttgaaatccatacgcacgcgacgaccggtctttccgttgcgacgctgctcaaagcggct
gaagccggtgcggatattttagatacggccatttcttccatgtcgatgggaacttcccat
agcccgacggaaacggtcgttgaaatgctcaaaggtaccgaactggataccggtctcgac
ctgaatacgctgcttgagattgccgcctatttccgcgacgtgcgcaaaaagtacgcaaaa
tttgaatcgagcttcctcggcgccgatacgcgcattcttgcgtcccaggttcccggcggt
atgctttcaaacctcgaaaatcagctgaaagaacagggcgcgtcggacaaaatcgacgac
gtactgaaagaaatccagatcgtgcagaaagactgcggctatattccgctcgttacgccg
accagccagattgtcggtacgcaggccgtattcaacgtcctgttcggccgctacgccaaa
ctgacgcaggaaacgcgcgatttggtaaccggcaaatacggaaaaacacccgccgccgtc
aacgcggatctgctgaaagaagcgctcaaacagaacaatatggacgctcccgttacctgc
cgcccggccgacctcattccgatggaatgggataaaatggttgaagaatcgaagactaac
ggcggcgacggcagtgaagaagacacgctgacctacgcgatgttcccgaaagtcgctccc
aaattcttcaaagaacgcgcaaacggtccggtcaaatccgaatctttcgcggtaaaaccc
gccgcttccgcagcatcgtcgaacggcggttcctatacggtaaacgtcaacggtacttcg
tacaacgttaccgcaggccccgcgggcgacgcgatgagcgttacggttaacggtaccgcg
tacaacgttgcgttctctgccgcagctgccgcgtccgcagctcccgccgcagccgtttcc
ggcggcgcaaccattaccgctccggttgcaggaacattgctcaagcacgtcgttcccgcc
ggttcgatggtcaaaaaaggcgacaccgttatcatggtcgaatccatgaagatggaactg
gaagttaaagcaaccgttgacggcccgattacgtatgccgttcagcccggctctcaaatc
gccgcgggtcaggtcatcgccaatatcggcggcggcgctcccgttgcagctcccgttcag
gcagcgcctgctgcggctcccgcagcacccgcacccgctgcggctccgtccggtaccggc
gcggtcattgcggctccggttgccggaacgctgctcaaaaatgttgttgctgaaggttcg
gccgtcaaatccggtgatacgatcatcatgatcgaatcgatgaaaatggaactggaagtc
aaggccgcctcaaacggaaccgtacacttccttgcctctgccggatcgcagatttctgcc
ggtcagccgcttgccgaaattaaataa

DBGET integrated database retrieval system