KEGG   Treponema brennaborense: Trebr_2154Help
Entry
Trebr_2154        CDS       T01489                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tbe  Treponema brennaborense
Pathway
tbe00010  Glycolysis / Gluconeogenesis
tbe00620  Pyruvate metabolism
tbe00640  Propanoate metabolism
tbe00680  Methane metabolism
tbe01100  Metabolic pathways
tbe01110  Biosynthesis of secondary metabolites
tbe01120  Microbial metabolism in diverse environments
tbe01130  Biosynthesis of antibiotics
tbe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trebr_2154
   00620 Pyruvate metabolism
    Trebr_2154
   00640 Propanoate metabolism
    Trebr_2154
  Energy metabolism
   00680 Methane metabolism
    Trebr_2154
Enzymes [BR:tbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Trebr_2154
Lipid biosynthesis proteins [BR:tbe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Trebr_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEE17569
UniProt: F4LKL3
Position
complement(2547066..2548757)
Genome map
AA seq 563 aa AA seqDB search
MILDRFVAGKSAYSSYEDLKENFSIRIPDNFNFAYDVVDEYARAEPDRRALVWCDDDGNE
KFFTFGDLKKASDKTANFLTMNGIRKGDAVMLILRRRYEFWFFILALHKIGAIAVPATHM
LLKKDIEYRNNAAGVKMIVSLEEPELQDQVEQALPDSPTVKTLVTVGPARSGWLCFHEAY
DSLSETFVRPTGELAAGNEDIMLLYFTSGTSGYPKMVQHDFTYPLGHIVTAKYWQNVVDG
GLHLTVAETGWAKAVWGKIYGQWLAGSAVFAYDMLSFVPGKLLEKMARYKVTTFCAPPTV
YRYLIKHDLSKYDLSSLTYCTTAGEALNAEVYNRFCEQTGLKMKEGYGQTELTLTIGNFA
WMEPKPGSMGKPAPGYEIDIVDAEGKSCAAGETGEIVIRLENGRPFGMFAGYYRDQELTD
AAFYGNLYHTGDTAYRDEDGYYWFVGRMDDMIKSAGYRISPFEVESTLLQHPAVLECAVT
GVADKKRSQVVKATIVPAPGFSPTQKLAQEIQDFVKHVTAAYKYPRLIEFVKELPKTISG
KIRRVEIREKDAQDRTAADENGR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataggttcgtcgccggaaaaagcgcatacagttcctacgaagatttaaaa
gaaaacttttccatccgtattcccgataacttcaattttgcgtacgacgtcgtggacgaa
tatgcccgtgccgaaccggatcgccgtgcgctcgtgtggtgcgacgacgacggtaacgaa
aaattttttacgttcggcgatttgaaaaaagcttccgacaaaaccgcgaatttcctgacg
atgaacggaatacgaaaaggcgacgcggttatgctgattttgcgccgccggtacgagttc
tggtttttcattctcgcactgcataaaatcggtgcgattgcggttcccgcgacgcacatg
ctgctcaaaaaagacatcgaataccgcaacaacgcggcgggtgtcaaaatgatcgtgtcg
cttgaagagcccgaactgcaggatcaggttgaacaggcgctgcccgattctccgacggtc
aaaacgctcgttaccgtggggcccgcccgctccggctggctgtgttttcacgaagcgtac
gactcgttgtctgaaacgttcgttcgaccgaccggtgaacttgccgccggtaacgaagac
atcatgctgctgtattttacgtcgggcacgtccggctatcctaaaatggtgcagcacgat
tttacgtatccgctgggccacatcgttacggccaaatattggcagaacgtggtcgacggc
ggactgcacctgacggttgccgaaaccggctgggcaaaagcggtgtggggtaaaatctac
ggtcagtggcttgccggcagcgccgtttttgcgtacgacatgctgtcgttcgttcccgga
aagctgcttgaaaaaatggcgcggtacaaggtgacgacgttttgcgcgccgccgaccgtc
tatcggtatcttatcaagcacgatctttcaaaatacgacctttcaagcctgacgtattgc
acgacggcgggcgaagcgctcaatgcggaagtatacaatcggttctgcgaacagaccggc
ctcaagatgaaagaaggttacggccagacggaactgacgctcacgatcggcaattttgcc
tggatggagccgaagcccggttccatgggaaaaccggcgcccggttacgagatcgatatc
gtcgacgccgaaggaaaatcctgtgcggccggcgaaacgggtgaaatcgttatcagactt
gaaaacggccgtccgttcggcatgttcgccggctattaccgcgatcaggaattgaccgac
gccgctttctatggaaatctgtatcacaccggagacacggcgtatcgcgacgaagacgga
tattactggtttgtcggccgaatggacgacatgataaaaagcgccggatatcgcatcagt
ccgttcgaggttgaaagcacgctgcttcagcatccggcggtcctcgaatgtgccgttacc
ggcgttgctgacaaaaagcgcagtcaggtcgtcaaagcgacgatcgttcccgcgcccggg
ttttctccgacccaaaaattggcgcaggagattcaggatttcgtaaagcacgtgaccgcc
gcgtataaatatccgcggctgatcgagttcgtcaaggaattgcccaaaacgatcagcggc
aaaatccgccgcgtggaaatacgcgaaaaagacgcgcaagatcggactgcggccgatgaa
aacggcagataa

DBGET integrated database retrieval system