KEGG   Thermobispora bispora: Tbis_0001Help
Entry
Tbis_0001         CDS       T01236                                 

Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
tbi  Thermobispora bispora
Pathway
tbi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tbis_0001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tbi03032]
    Tbis_0001
   03036 Chromosome and associated proteins [BR:tbi03036]
    Tbis_0001
DNA replication proteins [BR:tbi03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Tbis_0001
Chromosome and associated proteins [BR:tbi03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Tbis_0001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C IstB_IS21 AAA AAA_22 ATPase_2 DnaA_N AAA_16 RNA_helicase NACHT TniB
Motif
Other DBs
NCBI-ProteinID: ADG86738
UniProt: D6Y203
Position
270..1853
Genome map
AA seq 527 aa AA seqDB search
MEGVDLDAVWARALRTLLDEGVSGQQRAFLQMTQPSGLINDTILLAAPNDFAKEVIEVRL
RPLIAHALAQELGRPVRIAVMVDPSAVPDAGVDRPDRQPMTQPGQTGYPQHRPQTQPGFS
TGLTTGSPGLATGGESAARHEAGPYSSSVPRPGGLAGEPRPEPRPEPAHQRWDSRPSRSS
SEPARLNAKYTFETFVIGASNRFAHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHLLHAIG
HYAQSLYDGARVRYVSSEEFTNEFINSIRDHKADEFRARYRAVDILLVDDIQFLEGKEQT
QEEFFHTFNTLHNASKQIVISSDRAPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAIL
RKKAVQEGLAAPPEVLEYIASRISTNIRELEGALIRVTAFASLNRQPVDIELAEMVLKDL
ISEESSPEITISLIMSTTAEYFGVSIDDLCGSSRSRALVTARQIAMYLARELTDLSLPKI
GQQFGGRDHTTVMHAERKIRSLMAERRSMYNQVNELTTRIKQRARNG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcgtggatctcgacgctgtatgggctcgggcgctcagaaccctgctggacgag
ggcgtgtccgggcagcagcgcgcgttcctccagatgacccagccatccgggctgatcaac
gacacgatcctgctggccgctcccaatgacttcgccaaagaggtcatcgaggtacggctc
cggccgctgatcgcgcacgcgctggcgcaggagctcgggcggccggtgcgcatcgccgtc
atggtcgacccgagcgcggtccccgacgccggtgtggaccggcccgaccggcagccgatg
acgcagccgggccagacgggatatccacagcaccgcccgcagacgcagcccggtttctcc
acagggctcaccaccggttccccaggtctcgccacgggtggggagagcgcggcacggcat
gaggccgggccgtactcgtcctcggtcccgcggcccggcgggctcgcgggcgagccgcgg
cccgagcccaggcccgaaccggcgcaccagcggtgggacagccggccgagccggtcgtcc
agtgagcccgcccggctcaacgcgaagtacaccttcgagaccttcgtcatcggggcgagc
aaccggttcgcccacgccgcggccgtggcggtcgccgaggcgccggcgaaggcgtacaac
ccgttgttcatctacggcgactccggcctgggcaagacgcacctgctccacgcgatcggc
cactacgcgcagagcctctacgacggcgcccgcgtgcggtacgtgagctcggaggagttc
accaacgagttcatcaactcgatccgcgatcacaaggcggacgagttccgcgcgcggtac
cgcgcagtcgacatcctgctcgtggacgacatccagttcctggagggcaaggagcagacc
caggaggagttcttccacaccttcaacaccctccacaacgccagcaagcagatcgtcatc
tccagcgaccgcgcccccaagcagctcgtgacgctggaggaccggctgcgcaaccgcttc
gagtggggcctgatcaccgacgtccagccgcccgagctggagacccgcatcgcgatcctg
cggaagaaggcggtccaggagggcctcgccgcgccgcccgaggtgctcgagtacatcgcg
agccggatctcgacgaacatccgtgagctcgagggcgccttaatccgggtcacggcgttc
gccagcctcaaccggcagcctgtggacatcgagctcgccgagatggtcctcaaggacctg
atcagcgaggagtccagccccgagatcaccatttcgctcatcatgtcgacgacggccgag
tacttcggcgtctcgatcgacgacctgtgcggcagctcccgctcgcgggccctcgtcacc
gcgcgtcagatcgccatgtacctcgcccgtgagctcaccgacctgtccctccccaagatc
ggccagcagttcggcggccgggaccacaccaccgtgatgcacgccgagcggaagatccgt
tcgctcatggcggagcggcgctcgatgtacaaccaggtcaacgagctgaccacccgcatc
aagcagcgtgcgcgcaacggttga

DBGET integrated database retrieval system