KEGG   Thermobispora bispora: Tbis_1139Help
Entry
Tbis_1139         CDS       T01236                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tbi  Thermobispora bispora
Pathway
tbi00620  Pyruvate metabolism
tbi00630  Glyoxylate and dicarboxylate metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01120  Microbial metabolism in diverse environments
tbi01200  Carbon metabolism
Module
tbi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tbis_1139
   00630 Glyoxylate and dicarboxylate metabolism
    Tbis_1139
Enzymes [BR:tbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tbis_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADG87861
UniProt: D6Y8G4
Position
complement(1298127..1299713)
Genome map
AA seq 528 aa AA seqDB search
MSVEIKAPMHEGFDEILTPKALEFVATLHREFNPERKRLLRLRQERQAELSAGGTLRFLP
ETEHIRNDPDWRVAPPAPGLVDRRVEITGPVDRKMTINALNSGAKVWLADFEDANTPTWE
NTIRGQINLRDALDRTIDFSIGEKRYALKPDEELATIVVRPRGWHLPEKHVLVDGEEISG
SLFDFGLYFFHCAKRQIDKGKGPYFYLPKLESHLEARLWNDVFVRAQELLGIPRGTIRAT
VLIETITAAFEMEEILYELREHSAGLNAGRWDYLFSVIKKFRTRGREFLLPERNAVTMTA
PFMRAYTELLVRTCHKRGAHAIGGMAAFIPNRRDPEINRVALEKVRADKQRESNDGFDGS
WVAHPDLVPVCREVFDQVLGDRPNQLDRLREDVSVTAEDLLAVSKTPGQITEAGLRNNVD
VGIRYLAAWMGGQGAAAIHNLMEDAATAEICRSQVWQWIHNDVDLADTGERVTRELVERV
IEEELAKIAQEPGYDADLYAKATELFKEVALDDDFVEFLTLPAYARLP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgagatcaaggcacctatgcacgaggggttcgacgagatcctcacgccgaag
gccctcgagttcgtcgccaccctgcaccgcgagttcaaccccgagcgcaagcggctcctc
cggctccgccaggagcgccaggccgagctctcggcgggcggcacgctccgcttccttccc
gagaccgagcacatccgcaacgaccccgactggcgggtcgccccgcccgcgccgggcctg
gtcgaccggcgggtggagatcaccggcccggtcgaccggaagatgaccatcaacgcgctc
aactccggcgcaaaggtctggctcgccgacttcgaggacgccaacacccccacctgggag
aacacgatcaggggccagatcaacctgcgtgacgcgctcgaccggacgatcgacttctcg
atcggcgagaagcgctacgcgctcaagcccgacgaggagctcgccacgatcgtggtccgg
ccgcgcggctggcacctgcccgagaagcacgtgctggtcgacggcgaggagatctccggc
tcgctgttcgacttcggcctctacttcttccactgcgccaagcggcagatcgacaagggc
aagggcccgtacttctacctgccgaagctggagtcgcaccttgaggcgcggctgtggaac
gacgtgttcgtccgcgcccaggagctgctcggcatcccgcgcggcacgatccgggcgacc
gtgctgatcgagaccatcacggccgccttcgagatggaggagatcctctacgagctgcgc
gagcactcggcggggctcaacgccggccgatgggactacctgttcagcgtgatcaagaag
ttccgcacccgcggccgggagttcctgctgccggagcggaacgcggtgaccatgaccgcg
ccgttcatgcgggcctacaccgagctgctcgtccgcacctgccacaagcgcggcgctcac
gcgatcggcggcatggccgcgttcatcccgaaccgccgcgacccggagatcaaccgggtc
gccctggagaaggtgcgggccgacaagcagcgcgagtccaacgacggcttcgacggctcg
tgggtggcccaccccgacctggtcccggtctgccgcgaggtgttcgaccaggtgctcggc
gaccggccgaaccagctcgaccggctgcgcgaggacgtcagcgtcaccgcggaggacctc
ctcgccgtgtcgaagacgccggggcagatcaccgaggccgggctgcgcaacaacgtcgac
gtcgggatccgctacctcgccgcctggatgggcgggcagggcgcggccgccatccacaac
ctgatggaggacgcggccaccgccgagatctgccggtcgcaggtctggcagtggatccac
aacgacgtcgacctcgccgacaccggcgagcgggtgacccgcgagctcgtcgagcgggtc
atcgaggaggagctcgccaagatcgcccaggagcccggctacgacgccgacctctacgcc
aaggcgaccgagctgttcaaggaggtcgcccttgacgacgacttcgtcgagttccttacg
ctcccggcatacgcccgcctgccgtag

DBGET integrated database retrieval system