KEGG   Thermobispora bispora: Tbis_1910Help
Entry
Tbis_1910         CDS       T01236                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
tbi  Thermobispora bispora
Pathway
tbi00790  Folate biosynthesis
tbi01100  Metabolic pathways
tbi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tbis_1910
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tbis_1910
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Tbis_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: ADG88622
UniProt: D6YBR2
Position
complement(2210057..2211628)
Genome map
AA seq 523 aa AA seqDB search
MPGCSGDMRNGITRRSLLTALAAGAGGLLLPDAVVAARPVSRALRRDPFTLGIASGDPTG
TGVVLWTRLAPDPTAPDGLGGMPAHDVEVGWQLAADERFSKVVASGTAVARRETAHSVHV
EVDGLEPGREYFYRFRAGGHISPAGRTRTAPAGVSPLTFAMASCAHWEHGYYTAYRRIAE
LEPDLVVHLGDYIYEYRPLGYRAPGGAVREHVGGKCRTLADYRIRHAQYKTDPDLQAAHL
AAPWLVAFDDHEVENNWAGPESSLGTPDFLARRARAFRAYYEHMPLRRSRQRGTSIRIHR
RVHWGELASFHLLDTRRFRDDQACGDGERAGCHDRLDPGRTILGADQRRWLLDGLARSRA
RWNFIAQQVLMAQRDAMTGPGTRFNMDGWDGYAAERARLLHRIKEVGVANPVVLTGDAHM
HHAAELRPDFADPDSPRVAVELVTSSVSSDGDGYHDDARVAALLRENPHIAYLDERRGFV
VCRVTAEEMTVDFRTLGYVSRRGAPARTTARFTVRSGHPQLIA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgccggggtgcagtggagacatgcggaacggcatcacgcggcgctccctgctgaccgca
ctcgccgccggggcgggaggcctgctccttcccgatgcggtggtcgcggcccgcccggtc
tcccgggcgctccggcgggacccgttcaccctggggatcgcctccggcgaccccaccggc
accggcgtggtgctgtggacgcggctcgcccccgacccgaccgcgcccgacgggctcggc
ggcatgcccgcgcacgacgtcgaggtcggctggcagctcgcggcggacgagcggttctcc
aaggtggtcgcctccggcaccgccgtcgcccggcgggagacggcccacagcgtccacgtg
gaggtggacgggctggagccggggcgggagtacttctaccggttccgcgccggcgggcac
atctccccggccggccgtacccggacggccccggccggggtgtcgccgctcacgttcgcc
atggcctcctgcgcgcactgggagcacggctactacaccgcctaccgccggatcgccgag
ctcgagccggacctcgtggtgcacctgggcgactacatctacgagtaccggccgctgggc
taccgggcaccgggcggggcggtgcgcgagcacgtgggcggcaagtgccggacgctcgcc
gattaccggatccggcacgcccagtacaagaccgacccggacctgcaggcggcccacctg
gcggcgccgtggctggtcgccttcgacgaccacgaggtggagaacaactgggccgggccg
gagtccagcctcggcaccccggacttcctcgcgcggcgggcccgcgccttccgcgcctac
tacgagcacatgccgctgcgccgctcgcggcagcgcggcacgtcgatccggatccaccgg
cgggtccactggggagagctggcctccttccacctgctcgacacccgccgcttccgggac
gaccaggcgtgcggcgacggggagcgcgccgggtgccacgaccggctggaccccgggcgc
accatcctcggcgcggaccagcgccgctggctgctcgacggcctggcgcgctcgcgcgcc
cggtggaacttcatcgcccagcaggtgctgatggcgcagcgggacgcgatgaccggcccg
ggcacccggttcaacatggacggctgggacggctacgcggcggagcgggcccggctgctg
caccggatcaaggaggtgggcgtggccaacccggtcgtgctcaccggggacgcgcacatg
caccacgccgccgagctgcggcccgacttcgccgacccggactccccgcgggtggcggtc
gagctcgtcacctcctccgtctccagcgacggcgacggctaccacgacgacgcgcgggtc
gcggccctgctccgggagaacccccacatcgcctacctcgacgagcgccggggcttcgtc
gtgtgccgggtcaccgcggaggagatgaccgtggacttccgcaccctcggctacgtgagc
cggcgcggcgcgccggcgcggaccacggcccgcttcaccgtgcgctccgggcaccctcag
ctcatcgcgtag

DBGET integrated database retrieval system