KEGG   Thermobispora bispora: Tbis_2709Help
Entry
Tbis_2709         CDS       T01236                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tbi  Thermobispora bispora
Pathway
tbi00010  Glycolysis / Gluconeogenesis
tbi00071  Fatty acid degradation
tbi00350  Tyrosine metabolism
tbi00625  Chloroalkane and chloroalkene degradation
tbi00626  Naphthalene degradation
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01120  Microbial metabolism in diverse environments
tbi01130  Biosynthesis of antibiotics
tbi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbis_2709
  Lipid metabolism
   00071 Fatty acid degradation
    Tbis_2709
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tbis_2709
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tbis_2709
   00626 Naphthalene degradation
    Tbis_2709
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tbis_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADG89409
UniProt: D6Y5Z3
Position
3173238..3174242
Genome map
AA seq 334 aa AA seqDB search
MMDAWVVARPGPIATNPLERTRLPVPEPGPGELLIKVEVCAVCRTDLHLAEGDLPPRRPR
TVPGHEVVGRVTALGPGTEGPAPGTRVGVAWLRSTCGECRYCRRGAENLCPSSTYTGWDA
DGGYAEYLTAPADYVYPLPEDLPAEKLAPLLCAGIIGYRALLRCDLPPRGRLGIYGFGAS
AHITAQIAMAQGASVYVMTRSPAAQELARELGAVFVGGSADTPPEPLDAAILFAPVGELV
LPALEALDRGGTLAVAGIHLTDIPVLNYQRHLFQERTLRSVTANTRADGREFLRLVAAHP
PRITTTPYPFDAADRALQDLAADRVNGVAVLLME
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgcctgggtggtggcccgtccgggcccgatcgcgacgaaccctttggaacgc
acccggctgcccgtacccgagccggggccgggtgagctgctgatcaaggtcgaggtgtgc
gcggtctgccgcaccgacctgcacctcgccgagggggacctcccgccgcggcggccccgt
accgtgcccggccacgaggtcgtggggcgggtgaccgccctcggcccgggaacggagggc
ccggcgcccggcacccgggtcggcgtcgcctggctccgctccacctgcggcgagtgccgg
tactgccggcggggcgcggagaacctctgcccgtcctccacctacaccggctgggacgcc
gacggcgggtacgcggagtacctcaccgcgcccgccgactacgtctatccgctccccgag
gacctcccggccgagaagctcgccccgctgctgtgcgccgggatcatcggctaccgggcg
ctgctccgctgcgacctgccgccgaggggcaggctcggcatctacggcttcggcgcgtcc
gcgcacatcaccgcgcagatcgcgatggcgcagggcgcctccgtgtacgtcatgacgaga
tcgcccgccgcgcaggagctggccagggagctcggcgcggtgttcgtcggcgggagcgcg
gacacgccgcccgagccgctcgacgcggcgatcctgttcgcccccgtcggtgagctggtg
ctccccgcgctcgaggcgctcgaccggggcggcacgctcgccgtggcgggcatccacctc
accgacatccccgtgctcaactaccagaggcacctgttccaggagcggaccctgcgcagc
gtcaccgcgaacacccgcgccgacggccgggagttcctccgcctggtggccgcccacccg
ccccggatcaccacgacgccctacccgttcgacgccgccgaccgggcgctgcaggacctc
gccgcggaccgggtcaacggtgtcgcggtcctcctcatggagtga

DBGET integrated database retrieval system