KEGG   Thermobispora bispora: Tbis_2861Help
Entry
Tbis_2861         CDS       T01236                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tbi  Thermobispora bispora
Pathway
tbi00500  Starch and sucrose metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tbis_2861
Enzymes [BR:tbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Tbis_2861
Exosome [BR:tbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tbis_2861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ADG89560
UniProt: D6Y6R9
Position
3357510..3359690
Genome map
AA seq 726 aa AA seqDB search
MDLDRLAAGAHHDPHSILGAHPGPEGVTIRALRPLAEKVEAIVDGTAHELRHVAHGVFEV
TIPGLDKIPDYRLRITYPGAPPYETDDPYRHLPTLGEFDLHLIHEGRHERLWEVLGARVM
RHEDVDGTAFTVWAPNARGVRVIGDFNHWDGTACPMRSLGRSGVWELFLPGVGPGARYKF
QVLGIDGVWREKADPMARRTEVPPATASIVERSAYEWRDAEWMAARARRDPLTGPMSIYE
VHLGSWRPGLSYRRLAVELVEYVTEMGFTHVEFLPVAEHPFGGSWGYQVTSYYAPTARFG
TPDDFRYLVDELHRAGIGVILDWVPAHFPTDEWALARFDGTPLYEHADPRRGEHPDWGTY
VFDYGRNEVRNFLVANALYWLKEFHIDGLRVDAVASMLYLDYSRREGEWTPNIHGGRENL
EAIAFLKELNTVCYREVPGIVMIAEESTAWPGVSRPVHLGGLGFGLKWNMGWMHDTLKYL
SHDPIHRQYHHHEVTFSLVYAFSENFVLPLSHDEVVHMKGSLLAKMPGDEWQRFANLRAL
LAYMWAHPGKQLLFMGGEFGQGAEWSEAHGLDWWVLDFEYHRGVQRLVQDLNRIYRETPA
LYTRDFTPDGFRWIEANDAARNVLAFLRYGSDGSVLACVVNFAGIPHEDYHLGLPVGGRW
EEILNTDSFLYAGSGVGNLGAVEASATPCHGLPYSARLRLPPLGALWLRPATGSPARERD
ADGRSG
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgatcggctggccgccggcgcgcaccacgacccgcactcgatcctcggcgcg
caccccgggccggagggcgtcacgatccgcgcactgcggccgctcgccgagaaggtcgag
gccatcgtggacggcaccgcccacgagctgcggcacgtcgcccacggggtgttcgaggtg
accatccccgggctggacaagatcccggactaccggctgcggatcacctatccgggcgcg
ccgccgtacgagacggacgacccgtaccggcacctgccgaccctcggcgagttcgacctg
cacctcatccacgagggccggcatgagcggctgtgggaggtgctcggcgcccgggtcatg
cggcacgaggacgtcgacggcaccgcgttcaccgtgtgggcgccgaacgcccgcggcgtc
cgggtgatcggcgacttcaaccactgggacggcacggcctgcccgatgcgctcgctcggc
cggtcgggggtgtgggagctgttcctccccggggtcgggccgggggcccggtacaagttc
caggtcctcggcatcgacggcgtgtggcgggagaaggcggacccgatggcccgccggacc
gaggtcccgccggccaccgcgtcgatcgtggagcggtccgcgtacgagtggcgggacgcg
gagtggatggccgcccgcgcccggcgggatccgctcaccgggccgatgagcatctacgag
gtgcacctcggctcgtggcggcccgggctgtcctaccggcggctcgcggtcgagctggtc
gagtacgtcaccgagatgggcttcacccacgtggagttcctgccggtggccgagcacccg
ttcggcgggtcgtggggctaccaggtcacctcgtactacgcgccgaccgcccggttcggc
acccccgacgacttccgctacctggtggacgagctgcaccgcgccggcatcggggtgatc
ctcgactgggtgcccgcgcacttccccaccgacgagtgggcgctcgcccggttcgacggc
accccgctgtacgagcacgccgacccgcggcggggcgagcacccggactggggcacctac
gtcttcgactacggccggaacgaggtccgcaacttcctcgtcgccaacgcgctctactgg
ctgaaggaattccacatcgacggcctgcgcgtggacgccgtcgcctccatgctctacctc
gactactcgcggcgcgagggcgagtggaccccgaacatccacggcggccgggagaacctc
gaggcgatcgccttcctgaaggagctgaacacggtctgctaccgcgaggtgcccgggatc
gtgatgatcgccgaggagtccacggcctggccgggcgtgtcccgcccggtgcacctgggc
gggctcgggttcggcctgaagtggaacatgggctggatgcacgacacgctcaagtacctg
tcgcacgacccgatccaccggcagtaccaccaccacgaggtgaccttctccctggtgtac
gcgttctcggagaacttcgtgctgccgctctcgcacgacgaggtcgtgcacatgaagggg
tcgctgctcgccaagatgcccggggacgagtggcagcgcttcgccaacctgcgcgcgctc
ctggcgtacatgtgggcgcacccgggcaagcagctcctcttcatgggcggggagttcggc
cagggcgcggagtggtcggaggcgcacggcctcgactggtgggtgctcgacttcgagtac
caccggggcgtgcagcgcctggtgcaggacctcaaccggatctaccgggagacgccggcg
ctgtacacccgggacttcaccccggacgggttccggtggatcgaggcgaacgacgcggcg
cggaacgtgctggccttcctgcgctacggctcggacggctcggtgctcgcctgcgtggtg
aacttcgccggcatcccgcacgaggactaccacctgggcctgccggtgggcggccggtgg
gaggagatcctcaacaccgactccttcctctacgcgggcagcggggtggggaacctcggc
gcggtcgaggcgtccgccacgccgtgccacggcctgccctactcggcccggctccgcctg
ccgccgctcggcgcgctctggctccggccggccacggggtccccggcgcgcgagcgggac
gcggacggccggtccggctga

DBGET integrated database retrieval system