KEGG   Tetrapisispora blattae: TBLA_0A04290Help
Entry
TBLA_0A04290      CDS       T02489                                 

Gene name
TBLA0A04290
Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TBLA_0A04290 (TBLA0A04290)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TBLA_0A04290 (TBLA0A04290)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TBLA_0A04290 (TBLA0A04290)
    1.1.1.-  
     TBLA_0A04290 (TBLA0A04290)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 GATA NAD_binding_7 Pyr_redox Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 14493720
NCBI-ProteinID: XP_004177743
UniProt: I2GVS2
Position
1:1063289..1064476
Genome map
AA seq 395 aa AA seqDB search
MRALAYFGQGDVHFTKDLKEPTIEADDELMIDISWCGICGTDLKEYTEGAIFFPNDGECH
QISGEPLPQAMGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMC
NACKKGYYNICSKLGLCGAGVQSGGFAERVVMNESHCHKVPDDLPLDIAALIQPIAVCWH
ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKELGATVFDP
SSLPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIECLTFNGTAVNVAMWNHKPI
QFFPMAITSQEKRYMGSMCYTAEDFEAVIAAFESRSINWQLAEKLITGKVPIERGVDDAI
LQLLHNKEHTVKILLTPNNNNELGNKKSFRQLGKL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagctttagcatatttcggtcaaggcgatgtccattttactaaagatttaaaagaa
cccactattgaagctgatgatgaattgatgattgatatttcctggtgtggtatttgtggg
acagatttgaaagaatatacagaaggtgctattttcttccctaacgatggcgaatgccat
caaattagtggtgaacctttacctcaagctatgggtcatgaaatggctggtgtcgtttct
agagttggtccaggggttaagaaatttaaagtaggtgaccatgttgttgtcgaacctacc
ggtacttgtaaagatagatatcgttggaaaaatagtccaagtaagaacgatgatatgtgt
aatgcctgtaagaaaggttattataacatctgttccaaattaggtctttgtggtgctggt
gttcaaagtggtggttttgctgaaagagtagttatgaatgaatctcattgtcataaagtt
ccagacgatttaccattagatattgcagctttgattcaacctattgctgtctgttggcac
gctcttagaatctgtaatttcaaaaagggttcttctgccttagtcgtcggtagtggtcct
attggtcttggtatcattttagcattacatggccatggttgtactgacattgtcgtttca
gaaccagcaaaaattagaagagattttgccaaggaattaggtgctactgtctttgatcca
tcaagtctacctactcacgaagaaagtattaaatatttaagatctattgctccaggtggc
gatgggtttgattacacttttgattgctctggtaatcaatatacttttaacgcatctatt
gaatgcttaactttcaatggtaccgcagtaaacgttgccatgtggaatcataaaccaatc
cagttcttccctatggccattacatcacaagaaaagagatacatgggatccatgtgttac
actgctgaagattttgaagcagtcattgctgcattcgaatctcgttctattaattggcaa
ctagctgaaaaattaatcacaggtaaagtacccattgaacgtggtgttgatgacgccatt
ttacaattattacacaacaaggaacacactgttaagattcttctgacgccaaacaacaat
aatgaattgggcaataaaaagtcttttcgccagttgggtaaattgtaa

DBGET integrated database retrieval system