KEGG   Tetrapisispora blattae: TBLA_0A09860Help
Entry
TBLA_0A09860      CDS       T02489                                 

Gene name
TBLA0A09860
Definition
(RefSeq) hypothetical protein
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00500  Starch and sucrose metabolism
tbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TBLA_0A09860 (TBLA0A09860)
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     TBLA_0A09860 (TBLA0A09860)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase
Motif
Other DBs
NCBI-GeneID: 14493471
NCBI-ProteinID: XP_004178288
UniProt: I2GXB7
Position
1:2425001..2426323
Genome map
AA seq 440 aa AA seqDB search
MLLSLFTIATLSFQLLLAKANPIPHQSPLSLQFMNDRNEKRFYDYGTIKSPIRGVNIGGW
LVLEPYITPSLFERFRENPFNDDGIPVDEFHYCKYLGYDEAKSRLINHWDTFYTEQDFKD
IADKGLNLVRIPIGYWAFKKRDLDPFVTGYQEKYLDNAIEWSKKYGLKVWVDLHGAAGSQ
NGFDNSGLRDHLEFLNDDNLDVTLQALKYILEKYSREEFLDTVVGIELINEPLGGVIDMQ
KYKTQFLDVAYDYLRHTLKRNQIIVIHDTFLPNEYWDDFWTLKQDHWGVVIDHHRYEAFN
YGDLTSPIEMKVRTACAWGLSSIKDTHWSITGEFSAALTDCTKWLNGVGRGARYDGTLAS
NYAPIGSCKPFNDISQYTPEMRTNTRKFVEAQLDAFEMREGWIIWCYKTESSIEWDLKRL
IEYDLFPQPITSRKYPKQCE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgctattatcattgtttacaattgctacgctttcttttcaactgttattggcaaaagcc
aatcctattcctcaccaaagtcctttatctttacaatttatgaatgatcggaatgaaaaa
cgattttatgattatggaaccattaaatctccaattagaggtgttaatattggcggttgg
ctagtattggagccatatattactccatctctctttgaaagattccgggaaaatccattt
aatgacgatggcattcctgttgatgaatttcattattgtaagtatctaggctatgatgag
gctaagtcaaggctaattaaccattgggatacattttatacagaacaagatttcaaagat
attgcagataaaggattaaatttagttagaataccaatcggttactgggcttttaagaag
agagatcttgatccatttgtcacaggctaccaagagaaatatttagataatgcaattgaa
tggagtaaaaaatatgggttaaaagtctgggttgatttacatggtgctgctggttcccaa
aatggttttgacaactctgggttaagagaccatttagaatttttgaatgatgacaattta
gatgtcacattgcaagccttaaaatatatattagagaaatattcacgcgaagaattcttg
gatactgttgttggtattgagttgattaatgaacctctaggtggtgttattgatatgcaa
aaatataaaacacaattcctagatgttgcatatgattatttaagacatactttgaaaaga
aatcaaattattgtgattcacgacacatttttaccaaatgaatattgggatgacttttgg
actttgaaacaagatcattggggtgtagtaatcgaccaccacagatacgaggcatttaat
tatggtgatttaactagtccaatagaaatgaaagttagaacagcatgtgcatggggatta
tcttccattaaagatacacattggagtattacaggtgaattttctgcagcattaacagat
tgtacgaaatggttgaatggtgttggaagaggtgctcgctatgatgggactttggcttct
aattatgcaccaattggttcttgcaaaccttttaatgatatttcacaatacactcctgaa
atgagaacaaataccagaaagtttgttgaagcccagttagatgcatttgaaatgagagaa
ggttggataatttggtgctataaaacagaatcttcgattgaatgggatttaaagagattg
atagagtacgatttattcccacagcctattactagcagaaagtatccaaagcaatgtgaa
taa

DBGET integrated database retrieval system