KEGG   Tetrapisispora blattae: TBLA_0B00210Help
Entry
TBLA_0B00210      CDS       T02489                                 

Gene name
TBLA0B00210
Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00480  Glutathione metabolism
tbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TBLA_0B00210 (TBLA0B00210)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tbl02000]
    TBLA_0B00210 (TBLA0B00210)
Enzymes [BR:tbl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TBLA_0B00210 (TBLA0B00210)
Transporters [BR:tbl02000]
 Other transporters
  Pores ion channels [TC:1]
   TBLA_0B00210 (TBLA0B00210)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_2 GST_N_3 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 14493996
NCBI-ProteinID: XP_004178385
UniProt: I2GXL4
Position
2:complement(35114..36463)
Genome map
AA seq 449 aa AA seqDB search
MTSDMNGSGNSNGSGNGNSNGNPNISQLSNALHHINIRSNDINNNDIQNPNQNRNINNLN
EQNSEYALNSINSNNIMSNNTNNKSNDTGYINTDGSSNGAPQSIIYNYNSNISNSNSNND
SNNPTNTTHSSNNNLNLNSNNNISDNMTQPNDNSNSNIHIANNTNNNNNLNQTSQMRNNN
TNRQFLSGLSPIDNTRISSFFQDQPMEGYTLFSHRSAPNAFKVAIVLSELGLQYNTIFLD
FNKGEHRAPEFVGVNPNARVPALIDHNLDNLGIWESGAILLHLVNKYFKETGDPLLWADN
LADQSQINSWLFFQTSGHAPMIGQALHFEYFHSQKIPSAVERYTDEVRRVYGVVEMALSE
RREALVMDLDTENAAAYSSGTTPMSQSRFFDYPVWLVGDRISIADLAFVPWNNVVDRIGI
NIKAEFPEVYKWTKHMMRRPAVIKALRGE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgatatgaacggctcagggaatagtaatggatcaggaaatggaaatagcaat
gggaacccaaatatttctcaattatcaaatgctttacatcacatcaatattagaagtaat
gatataaataataatgatatccagaatccgaatcaaaatcgaaatataaataatttgaat
gaacaaaactccgaatatgcattaaactccatcaatagtaataatattatgagcaataac
acaaataacaaatctaacgacacagggtatataaatacagatgggtcctctaatggggcc
cctcaatcaataatttacaattacaacagcaatatttctaattcgaattcaaataatgat
tctaataaccctactaatactactcatagctcaaataacaatcttaatcttaattccaat
aataatatttctgataacatgacccaacctaatgacaattctaattcaaacatacatata
gctaacaatacgaataataacaataatttaaatcaaacttctcaaatgagaaataacaat
actaatcgtcaatttttatctgggttgagtccaattgataatacaagaatttcttcattt
ttccaagatcaaccaatggaaggatacacacttttttctcatagatcggcaccaaatgcc
ttcaaagtagctattgtattaagtgaactaggtttacagtataacactatttttttagac
tttaataagggagaacacagagctcctgaatttgttggtgtaaatccaaacgcaagggta
ccagccttaatagatcataatttggataatttggggatttgggaatctggtgctatttta
ttacatcttgtaaacaagtactttaaggaaactggcgatccattgttatgggctgataac
ttggcagatcaatcacaaatcaattcttggttatttttccaaacttctggccatgcacca
atgattggtcaagctttacactttgaatatttccattctcaaaagataccaagtgctgta
gagagatatacagatgaagttagaagagtttatggtgtagtagagatggcactttcagaa
agaagagaagccttagtaatggatttggatactgaaaatgcagctgcatattcttcagga
accactccgatgtctcaaagcagatttttcgattatccagtttggttagttggtgatagg
atctctatcgctgatttagcatttgttccttggaataatgtagttgataggattggtata
aatattaaagcagaattcccagaagtatataaatggacaaagcatatgatgagaaggcca
gcagtaataaaagctttacggggcgagtaa

DBGET integrated database retrieval system