KEGG   Tetrapisispora blattae: TBLA_0B08330
Entry
TBLA_0B08330      CDS       T02489                                 

Gene name
TBLA0B08330
Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00100  Steroid biosynthesis
tbl01100  Metabolic pathways
tbl01110  Biosynthesis of secondary metabolites
Module
tbl_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TBLA_0B08330 (TBLA0B08330)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TBLA_0B08330 (TBLA0B08330)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 14493815
NCBI-ProteinID: XP_004179167
UniProt: I2GZU6
Position
2:1990971..1992314
AA seq 447 aa
MSKQIKSDLAKLNPRTVTPDFGGSIGAFGLSVGLPILAIVLNLLIRQDYHLDGMFFQNFD
INQLIIGFSQLIHHFKENFNQLITFYLLWFTILAILDILLPGKMMDGTLMRDNTRLVYKI
NGLTMTITLALVLILRWQLTEGQMPEFQWLYANHTSLCIIAVLWAFVVATFCYIFSFVPP
ILGSKDYKLLAVGGNSGNVISDWFLGRELNPRIGPLDVKMFCELRPGMLLWLLIDLSCLH
HVYLESGKIHDALLLITLLQSWYVIDGVINEAGVISMVDITTDGFGFMLAFGDLALVPFT
YTLQARYLSVADFDTTTLGSIKCGIVILMAMFGYYIFHASNYQKADFKAGKLSHLKSIST
HTNTKLLCDGWWKVSQHINYFGDWIMAFSWCLTTWNHSLLTYYYIFYFAGLLIHRQNRDE
IKCSKKYGNAWKTYVSKVPYKIVPYIY
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgtccaagcaaataaaaagtgatttagctaaactaaatccgagaacagtaactccggat
tttggtgggtcaattggtgcatttggcctatcagtggggttaccaatactagccattgta
ttaaatctactaattcgtcaagattatcacttggatggcatgtttttccaaaatttcgac
attaatcaactaattattggattttctcaattaatacatcattttaaggaaaattttaac
caactaataacattctatttgttatggtttaccattttagcaattttggatattttatta
ccaggcaaaatgatggatgggactttaatgagagataatacaagattggtttataagatc
aatggcttaacaatgacgattacattagccctagtattaatcttacgttggcaattaact
gaaggtcaaatgcctgaattccaatggttatatgctaatcatacttctttatgtataatt
gctgtattatgggcattcgtagtggctacattttgctatattttttcatttgttccacct
attttaggttctaaagattataaattactagctgttggtggtaattcaggtaatgtaatt
tcagattggttcttaggtagagaattaaatcctagaattggtccacttgatgttaaaatg
ttctgtgaattacgtcctggtatgctactatggctattgatagatttatcatgtcttcat
cacgtttatttagaaagtgggaaaattcatgatgctttattattgattactcttttgcaa
agttggtatgtgattgatggtgttattaatgaagctggtgtcatctcaatggtggatatt
actactgatggattcggtttcatgttagcctttggtgatttggctttagttccatttact
tatactttacaggcaagatatttaagtgttgccgattttgatacaacaacattaggctcg
atcaaatgtggtattgtaattttaatggcaatgtttggttattacattttccatgcgtct
aattaccaaaaagcggatttcaaggcaggaaaattatcacatttgaaaagtatatctaca
catacaaacactaaattattatgtgatggttggtggaaagtctcacaacatattaattac
tttggtgattggattatggcattttcttggtgtctaacaacttggaatcattctttattg
acttattattacatattttattttgctggtttgttaatccatagacaaaatagggatgaa
attaaatgtagtaagaaatatggtaatgcttggaaaacttatgtttcaaaagtaccatat
aaaattgttccttatatatattaa

DBGET integrated database retrieval system