KEGG   Tetrapisispora blattae: TBLA_0C02180Help
Entry
TBLA_0C02180      CDS       T02489                                 

Gene name
TBLA0C02180
Definition
(RefSeq) hypothetical protein
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TBLA_0C02180 (TBLA0C02180)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbl01007]
    TBLA_0C02180 (TBLA0C02180)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbl03016]
    TBLA_0C02180 (TBLA0C02180)
   03029 Mitochondrial biogenesis [BR:tbl03029]
    TBLA_0C02180 (TBLA0C02180)
Enzymes [BR:tbl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     TBLA_0C02180 (TBLA0C02180)
Amino acid related enzymes [BR:tbl01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   TBLA_0C02180 (TBLA0C02180)
Transfer RNA biogenesis [BR:tbl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TBLA_0C02180 (TBLA0C02180)
Mitochondrial biogenesis [BR:tbl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TBLA_0C02180 (TBLA0C02180)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b
Motif
Other DBs
NCBI-GeneID: 14495010
NCBI-ProteinID: XP_004179549
UniProt: I2H0X8
Position
3:complement(515798..517789)
Genome map
AA seq 663 aa AA seqDB search
MTIDNTTKTTVPFSREQLESVLKTRFFYAPAFELYGGVSGLYDYGPPGCAFQANIVDVWR
KHFILEEDMLEVDCTMLTPHEVLKTSGHVDKFSDWMSKDPKTGEIFRADHIVEEVLEARL
KGDQEARGLVKDANAAVQENADKKKRKKKVKQIEAIKLDDDIVKEYETVLAKIDGYSGED
LGKLMVKYNIGNPVTGDPLEPPRAFNLMFETAIGPSGQMKGYLRPETAQGQFLNFNKLLE
FNNNKTPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHFLDPLDKSHPRFHEVNDIVL
PFLPREVQESGSTTPIVTTIGEAVSSGMVDNETLGYFIARIYLFLVSIGVDDTKLRFRQH
MANEMAHYATDCWDGELLTSYGWIECVGCADRSAFDLTVHSKKTKEKMVVRQKLEKPIEV
TKYEIDLTKKLFGPKFRKDAPKVEAFLLNLSQEELEKNAKLLKDNGKITFNVEGVESEVE
LDEKFVVIEKRTKIEHVREYVPNVIEPSFGIGRIIYAVFEHSFWSRPEDTARSVLSFPPL
VAPTKVLLVPLSNNKELVPVTTEVSKILRKEKIPFKVDDSGVSIGKRYSRNDELGTPFGI
TIDFESAKDKSVTLRERDSTKQVRGSIEEVIKAIKEITYEGSSWEESTKNLTPFTSTQTE
ETV
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgactattgacaacaccaccaaaactactgttccattcagtagagagcaattagaaagt
gttttaaaaaccagattcttttacgccccagcttttgaattatatggtggtgtttctggt
ttatacgattatggtccaccaggttgtgctttccaagccaatattgttgatgtttggaga
aagcatttcattttagaagaagatatgttagaagttgactgtaccatgttaactccccat
gaagttttaaaaacttctggtcatgttgacaaattctctgattggatgtctaaggatcca
aaaacaggtgaaatttttagagctgatcatattgtggaagaagtcttggaagctcgtttg
aaaggtgatcaagaggcaagaggtttagtgaaagacgccaatgctgcagtccaagaaaat
gctgataaaaagaagagaaagaagaaggttaagcaaattgaagctataaaattagatgac
gatattgttaaggaatatgaaactgttttggccaaaattgacggttattctggtgaagat
ttgggtaaattgatggttaaatataatattggtaacccagtcactggtgatccactagaa
ccaccaagagctttcaacttgatgtttgaaacagctattggtccatctggtcaaatgaaa
ggttatttgagaccagaaactgctcaaggtcaatttttaaatttcaataaattattagaa
tttaacaacaataagactccatttgcttctgcttctattggtaaatctttcagaaacgaa
atttctccaagagctggtttgttgagagtccgtgaattcttgatggcagaaattgaacat
ttcttggatccattggataaatctcacccaagattccatgaagttaatgatattgtatta
cctttcttaccacgtgaagttcaggaatcaggctctaccacaccaattgttacaactatt
ggtgaagctgtctcgtctggtatggttgataatgaaactttaggttatttcattgctaga
atttacttatttttagttagcattggtgttgatgacactaaattaagattccgtcaacat
atggctaatgaaatggcccattatgctaccgattgttgggatggtgaattgttgacctca
tatggttggattgagtgtgttggttgtgctgatagatcagctttcgatttgactgttcac
tctaagaaaactaaggaaaaaatggttgttagacaaaaattagaaaaaccaattgaagtt
accaaatacgaaattgatttaaccaaaaaattatttggtccaaaatttagaaaggatgct
ccaaaagttgaagctttcttattaaatttatctcaagaagaattagaaaagaacgccaaa
ttattaaaggacaatggtaagattactttcaatgtggaaggtgtcgaatctgaagttgaa
ttagatgaaaaatttgttgtaattgaaaagagaactaagattgaacatgttagggaatat
gttccaaatgttatcgaaccatctttcggtattggtcgtatcatctatgccgtttttgag
cattctttctggagcagaccagaagatactgctagatcagtcttatctttcccaccattg
gttgcaccaactaaagtcctgttagtaccattatctaacaacaaagaattagttcctgtt
actacagaagtttctaaaatcttaagaaaagagaagattccatttaaagttgatgactct
ggtgtgtcaattggtaagagatactctcgtaatgatgaattaggtactccatttggtatt
accatcgacttcgaatctgctaaggacaaatctgttactttaagagaaagagattctaca
aaacaagtaagaggttctattgaagaagttattaaagccatcaaagaaatcacttacgaa
ggttctagctgggaagaaagtactaaaaatttgacaccattcacttcaactcaaactgaa
gaaactgtatag

DBGET integrated database retrieval system