KEGG   Tetrapisispora blattae: TBLA_0C05100Help
Entry
TBLA_0C05100      CDS       T02489                                 

Gene name
TBLA0C05100
Definition
(RefSeq) hypothetical protein
  KO
K11378  histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TBLA_0C05100 (TBLA0C05100)
Chromosome and associated proteins [BR:tbl03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    NuA3 complex
     TBLA_0C05100 (TBLA0C05100)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MOZ_SAS Acetyltransf_7 TraC_F_IV
Motif
Other DBs
NCBI-GeneID: 14495286
NCBI-ProteinID: XP_004179825
UniProt: I2H1Q4
Position
3:1235305..1237227
Genome map
AA seq 640 aa AA seqDB search
MTPLPRFLRNLQIDDNVHSGIAAAVLRDPDARPAKRPRHVTATPQPSKSPDVLVPQQLPE
HVHSLNPELADTPSAENAGDSRYNTWRLPQSRAEADALSDYVLFPRTIARSHSLGKDYNP
NVVGLKYDPHVFFNFHRLARVRPKQREIEERQRLSDKSRDAKHHVTHHVPRTIPSRADRR
RFRRLLTDSLPASNVNTNVPLTNIDNPITNISEFTSSDGIQYVYLDDREIKTWFRSPFPP
HLNRNKLLFVCQHCLRYTGSRYAHTRHRVKCPVTFPPGNEVYRDGILSIWEVDGREQVRY
CRALCLLARLFLHSKTLYYDVEPFIFYVLTERAADGKCRLVGYFSQEKLSAADYNLSCIL
VLPTYQRRGYGHFLIDFSYLLSRRSFKWGTPEKPLSDLGLLSYRSFWTLKVCQTLQMLKP
LAERADDGDDFNITLELLANLTGMLPVDIVFGLEQLQLLYHKPTSHKYSIRINDWQIIDS
IVDRWNAKGYATLDPTKLLWKPMIFGPSCGVNAVGTIETSSVSTPANPNIFVNKPTSPDP
FKKSIEMLVNFMQDDLADPRTMERSTLDTLINNPIITTSEFYHPGEWKLCFIQPQLNHKD
LQLSRKRYKSKRQLIDEEDGLLHTDDDTSSLTDVNIDSNI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgactccattgcctcgtttcctacgaaacctccagattgatgataatgttcactctgga
attgcagctgccgtgcttcgtgatcccgatgctcgtccggctaagcgcccacgccacgtg
acagccactccacagccgtcgaagtcacctgacgtactggtgccacagcaattgccagag
cacgtgcactctttaaatccagaattagcagatacgccatcagcagaaaacgctggcgat
tctcgctataacacctggcgactgcctcagtcacgtgcagaggctgacgcgttgagcgac
tatgtactatttccacgtacgattgcaagatctcattcattgggtaaggattataatcca
aatgtagtaggattgaagtatgatcctcatgtgttttttaatttccatcgtttggcacgt
gtgcgaccaaaacaacgagaaattgaagaaagacagagattgagtgataagtcacgtgat
gcaaagcatcacgtgacacatcatgtgccacgaactattccgtcacgtgccgaccgtcgg
cgattccgtcgtcttctaacagattccttacctgcttctaatgttaatactaatgttcct
cttacgaatattgataatccaattacaaatatttctgaattcacttcttctgatggcatt
caatacgtttatttagatgatcgtgagattaaaacttggttccgttcacctttcccacct
catcttaatcgtaataaattattatttgtttgtcaacattgtttacggtatactggttcc
cgttatgctcatacacggcatcgtgtgaaatgtccagtaacttttcctccaggaaatgaa
gtttatcgtgatggtattctttccatatgggaagtagatggtcgtgaacaagtacgttat
tgcagagcactttgtctcttggctagacttttcttacattccaagactttatattatgat
gtggaaccctttatattttatgttttaactgaaagagccgccgatggcaaatgtcgactg
gtaggctatttttcacaagaaaaattaagtgctgctgattataatttaagttgtatcttg
gtattacccacttatcaacgacgtggatatggccattttttaattgatttttcatatcta
ttatctcgtcgttcattcaaatgggggacaccagagaaacccttgtctgatttaggttta
ctctcatatcgtagcttttggactcttaaagtatgtcagactttacaaatgttaaaacct
ttagcagaacgtgctgatgatggtgatgatttcaatatcactttggaattattagcgaac
cttactggtatgcttccagtagatatagtatttggattagaacaattacaacttttgtat
cataaacccacgtctcataaatattccattcgaattaatgattggcaaattatagattcc
attgtcgatcgttggaacgctaaggggtatgctacgttggatccaacaaaattgttatgg
aaaccaatgatttttggtccctcgtgtggtgttaatgctgtggggactattgaaacaagt
tctgtaagcacacctgcaaacccaaacatctttgtcaataaacctacaagtcccgaccct
ttcaaaaaatctattgaaatgttggtcaatttcatgcaagatgatcttgcagatcctcgt
acaatggaacgttctactttggacaccctaataaataatccaattataacaacttcagaa
ttttatcatccaggtgaatggaaattatgttttattcagccacagttaaatcacaaggac
ttacaattatcaaggaaaaggtataaatcaaaaagacaattaatagatgaggaagatggg
ttacttcatacagatgatgatacttctagtttgaccgatgtaaatatagattcaaatata
taa

DBGET integrated database retrieval system