KEGG   Tetrapisispora blattae: TBLA_0C06770Help
Entry
TBLA_0C06770      CDS       T02489                                 

Gene name
TBLA0C06770
Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00450  Selenocompound metabolism
tbl00970  Aminoacyl-tRNA biosynthesis
tbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TBLA_0C06770 (TBLA0C06770)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TBLA_0C06770 (TBLA0C06770)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbl01007]
    TBLA_0C06770 (TBLA0C06770)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbl03016]
    TBLA_0C06770 (TBLA0C06770)
Enzymes [BR:tbl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TBLA_0C06770 (TBLA0C06770)
Amino acid related enzymes [BR:tbl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TBLA_0C06770 (TBLA0C06770)
Transfer RNA biogenesis [BR:tbl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TBLA_0C06770 (TBLA0C06770)
 Prokaryotic type
   Other AARSs
    TBLA_0C06770 (TBLA0C06770)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g MetRS-N tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 14495449
NCBI-ProteinID: XP_004179988
UniProt: I2H267
Position
3:complement(1633214..1635466)
Genome map
AA seq 750 aa AA seqDB search
MSLKLAFDSGKNHSQGLTYANNLKLALAQQFASKGTKIEIDTEARQLQLTKGDNLRLVSA
DAILRYIMNDFSGQDSDEYDFSLASLESLLYHTSPPSNHIDQCVEKALDNYLTSLSEPLT
ATRLITYANASALRPALVNAKFPELPKSIATAVTDALKLSPRDTSSFKHTGASYITAGLG
VNKQAGKILPKDGERNILITSALPYVNNVPHLGNIVGSVLSADIFARYCKTRNYNTLFIC
GTDEYGTATETKALEEKCTPRELCDKYHKIHADVYKWFQVGFDHFGRTTTEKQTEIAQDI
FLKLNKNGYLEEQSMKQLYCPVHNSYLADRYVEGECPKCHYEDARGDQCDKCGSLLDPFE
LIKPRCKLDNSEPIPKVSDHIFISLDKLEGKIQNWFDESSEKGKWSKNSKTITQSWLKDG
LHPRCITRDLVWGTPVPLEKYKEKVLYVWFDATIGYVSITANYTDGWEKWWKDPENVKLY
QFMGKDNVPFHTVIFPGSQIGTGDKWTMLHHLNTTEYLQYEGGKFSKSRGVGVFGNNAQD
SGVSPSVWRYYLASVRPETNDSHFSWDDFVARNNGELLANLGNFVNRLIKFVNAKYNGVV
PKYDTKNLPGFDNLNKDINQILSNYIKEMEDAHERRGLELAMSLSSRGNLFLQDNKLDNS
LFSQHPDKSDAVVGVGLNIIYTVSSVIYPFMPEISETIYKMLNAPALKIDDKFHLAIESN
HNINKAEYLFHRIDDKQITEWRAKYGGKQV
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaaaattagcatttgattcaggtaagaatcattctcaaggcttaacttatgcc
aataatttaaaattagcattggctcaacaatttgcttcaaaaggaactaaaattgaaatt
gatacagaagcaagacagctacaattaacaaagggtgataaccttcgtttagttagcgca
gatgccattttaagatatatcatgaatgactttagtggtcaagattctgacgaatatgat
ttctctttggcttcattggagagtttgctttaccatacttcgcctccatcaaatcatatt
gatcaatgcgttgaaaaagctttagataactatttaacctctttatctgagcctttaact
gctactagattgattacttatgccaacgcgagtgccctaaggccagctttagtcaatgct
aaattcccagaactaccaaaatcaattgctactgctgttacagatgctttaaaactatct
ccaagagatacgtctagtttcaagcatactggtgcttcttatatcactgctggtttaggt
gttaataaacaagctggtaaaattttgccaaaagatggtgaacgtaatattttaattact
tcggctttaccttatgttaacaatgttcctcatttaggtaatattgttggtagtgttttg
tctgccgatatatttgctcgttattgtaaaactagaaattataatactttattcatttgt
ggtactgacgaatatggtaccgccactgagactaaagctttagaagaaaaatgcacacca
cgtgaattatgtgacaaatatcataaaattcatgcagatgtttacaaatggttccaagtt
ggttttgatcactttggtagaactactaccgaaaagcaaactgaaattgctcaagacatt
ttcttaaagttaaataaaaatggttacttagaagaacaatctatgaaacaattatactgc
ccagttcataattcatacttggcagacagatatgttgaaggtgaatgcccaaaatgtcat
tatgaagatgctcgtggtgatcaatgtgacaaatgtggtagcttattagatccatttgaa
ttgatcaaacctcgctgtaaattagataattctgagccaattccaaaagtttccgaccat
atttttatttcattagacaaattagaaggcaagatccaaaactggttcgatgagtcttct
gaaaagggtaaatggtctaaaaattccaaaactattactcaatcatggttaaaggatggt
ttacatccacgttgtatcactagagacttagtttggggtactccagtaccactagaaaaa
tataaggaaaaggtgttatacgtttggtttgatgctaccattggttacgtttcaattact
gctaattacactgatggttgggaaaaatggtggaaagacccagaaaatgttaaattatat
caatttatgggtaaagataatgtacctttccacactgttattttcccaggttctcaaatt
ggtactggtgataaatggactatgctacatcatttgaatacaactgaatatttacaatac
gaaggaggtaagttctccaaaagtagaggtgtgggggttttcggtaataatgcccaagac
tctggtgtttctcctagtgtctggagatattacttggcttccgttagaccagagactaat
gactctcatttctcttgggatgattttgttgctagaaataatggtgaattattagctaac
ttaggtaactttgttaacagattaattaaatttgttaatgctaaatataatggtgttgtt
ccaaagtatgataccaagaatttaccaggctttgataacttgaataaagacattaaccaa
atattgagtaattatatcaaagaaatggaagatgctcatgaaagacgtggtttagaattg
gctatgtccctaagttccaggggtaacttgttcttgcaagataataaattagataacagc
ttattctctcaacatccggataaatcagacgctgttgttggtgttggtttgaatatcatt
tacactgtttcctctgtcatatacccatttatgccagaaatctcagaaactatctacaaa
atgttaaatgcaccagctttaaaaattgatgataagttccatttagctatcgaatccaac
cacaatattaataaggctgaatatcttttccatcgtattgatgataaacaaattactgaa
tggagagctaaatatggtggcaagcaagtttaa

DBGET integrated database retrieval system