KEGG   Tetrapisispora blattae: TBLA_0D02780Help
Entry
TBLA_0D02780      CDS       T02489                                 

Gene name
TBLA0D02780
Definition
(RefSeq) hypothetical protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00670  One carbon pool by folate
tbl01100  Metabolic pathways
tbl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TBLA_0D02780 (TBLA0D02780)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     TBLA_0D02780 (TBLA0D02780)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Macoilin
Motif
Other DBs
NCBI-GeneID: 14495815
NCBI-ProteinID: XP_004180298
UniProt: I2H327
Position
4:complement(680732..682945)
Genome map
AA seq 737 aa AA seqDB search
MNIIQQSTPINASRKITELYKERTSPCVSLEFFPPKTEPGKRNLLDRIGRMSALEPLFVT
VTWAAGGTAADKTLELSTIIQQDLNIPVCMHLTCTNMDKTIIDEALEVCKRIGIRNILAL
RGDPPSGDDWLDFQMDQECDNFRYASDLVRYIKKNYDDYFCIGVAAYPEGHYGTDDDDTD
ADMEIKQDPIKDLPYLKEKIEAGADFVITQLFYDVDNFLKFEQVFREQIQNDSILLFPGL
MPINSFLLFNRAAKLSHATIPSSILDQFPVEIQNDDNIVKSIGIKILINIIEEIYAKTNG
RINCFHFFTLNLEKAIAQIVAKSTTLSSILEDSNVSDNHSTMPQIHRQPQPQSQLNNFPH
TVSNTELNESRNTDNDEDLILIDAEEDNSNNNRVTNGTTSTTYLEENKKRRRRRSSSTIN
YNDNDDNSRTTINRNSIPHNMNSTSNAININHSNMPSRKVLISISQGSGTLGRNATWDEF
PNGRFGDSRSPAYGEIDGYGPSLKVSYKKAIELWGKPLNFDDIKNIFIKYLEGSIDSLPW
SDLGLSPETGLIQEELIELNEMGYLTLSSQPATNGTSSTDKIFGWGPAHGVVYQKAFIEM
FISKNQWDTILKPKLDRYGSSKYTYYVGDVNGKFDSHQTYDSENNEYPNGNSDGSSSVVT
WGVFPNSEIIQSTIIEEESFKAWRDEAFAIWLEWIKLFPINSPTRIFLNKLRNEFCLVSI
VHHDFIKTDELWEMLLE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatacaacagtccaccccaataaatgcttcgaggaaaattactgagctttat
aaagaacgaacctcaccatgtgtatcattggaatttttcccaccaaaaactgaacctggt
aaaaggaatttgttagatcgtattggtagaatgtctgccttagaacccttatttgtaaca
gtaacatgggcagcaggtggaactgcagcagataaaacattagaattatctactattatt
caacaagatctaaatattccagtttgtatgcatttaacctgtaccaatatggataaaact
attattgacgaagcgttagaggtttgcaaaagaattggtatcaggaatatattggcatta
agaggtgatccaccaagcggtgatgattggctagattttcaaatggatcaagaatgtgat
aatttcagatatgcatcagacttagtacgatatattaaaaaaaattacgacgattatttt
tgcattggtgttgcagcctatccagaaggtcattatggaactgacgatgatgatactgat
gcagatatggaaattaaacaagatcctataaaagatttaccatacttgaaagagaaaatt
gaagcaggtgctgattttgtaattactcaattattttacgatgttgacaactttttaaaa
ttcgaacaggtatttcgtgaacaaattcaaaacgatagtatcttattattcccgggattg
atgccaataaattccttcttactattcaatagagcagcgaaactttcacatgcgactatt
ccttctagcatattagatcaatttcctgtagaaatccaaaacgatgataatattgttaaa
tctattggtattaaaatattaataaatataatcgaggagatttatgccaaaacaaatggt
agaattaattgcttccatttcttcaccttaaacttagagaaggccattgctcaaattgtt
gcaaaatctaccacattgtcaagtatattagaagattctaatgttagcgataatcattct
actatgccacaaatccatcgtcaaccacaaccacaatcacaactgaataattttccacac
actgttagcaatactgaattgaatgaatctaggaatacagataatgatgaagatcttata
ttaattgatgccgaagaagataatagtaataataatcgtgtcactaatggtactaccagt
actacttatttagaggaaaataaaaagagaagaagaagaagatcgagttcaactataaac
tataatgataatgacgataactctagaactactattaatcgaaattccattccacataat
atgaactccacgtctaatgcaattaatataaatcattcaaatatgccatcgagaaaagta
ttgatatctatttcgcaaggttctggtactcttggacgtaatgctacatgggatgaattt
ccaaatggtagatttggtgactctagatcacctgcgtatggtgagattgatggttatggt
ccaagtttaaaagttagttataaaaaagccattgaattatgggggaagccattgaatttc
gatgatattaagaatatatttattaaatatttagaaggatcaattgattcgttaccttgg
agtgatttaggtctttcacctgaaactggcttaattcaagaagaattgattgaattaaat
gaaatgggatatttaacattgtcatctcaacctgctacaaatggtacatcaagcacagat
aaaatatttggttggggtccagcgcatggtgttgtttatcaaaaggcatttattgaaatg
tttatatcaaagaatcaatgggatacgattttaaaaccaaaattagatagatatggatcg
agtaaatatacctattatgttggggatgtgaatggtaaatttgatagtcatcaaacttat
gatagcgaaaataatgaatatccaaatggaaatagtgatggaagttcttcggttgtaaca
tggggtgtttttcccaacagtgaaattattcaaagtacaattattgaagaggaatcattt
aaggcgtggagggatgaagcatttgcaatttggctagaatggattaaactattcccaatt
aattctcctactcgtatttttttgaacaagttgcgtaatgagttttgtttggtatctatt
gttcatcacgattttatcaagacggatgagttatgggaaatgctattagaatag

DBGET integrated database retrieval system