KEGG   Tetrapisispora blattae: TBLA_0D04470Help
Entry
TBLA_0D04470      CDS       T02489                                 

Gene name
TBLA0D04470
Definition
(RefSeq) hypothetical protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00061  Fatty acid biosynthesis
tbl00071  Fatty acid degradation
tbl01100  Metabolic pathways
tbl01212  Fatty acid metabolism
tbl04146  Peroxisome
Module
tbl_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TBLA_0D04470 (TBLA0D04470)
   00071 Fatty acid degradation
    TBLA_0D04470 (TBLA0D04470)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    TBLA_0D04470 (TBLA0D04470)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tbl01004]
    TBLA_0D04470 (TBLA0D04470)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tbl04147]
    TBLA_0D04470 (TBLA0D04470)
Enzymes [BR:tbl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     TBLA_0D04470 (TBLA0D04470)
Lipid biosynthesis proteins [BR:tbl01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   TBLA_0D04470 (TBLA0D04470)
Exosome [BR:tbl04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   TBLA_0D04470 (TBLA0D04470)
  Exosomal proteins of breast cancer cells
   TBLA_0D04470 (TBLA0D04470)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding DUF2104
Motif
Other DBs
NCBI-GeneID: 14495979
NCBI-ProteinID: XP_004180462
UniProt: I2H3J1
Position
4:1107031..1109292
Genome map
AA seq 753 aa AA seqDB search
MEEPDYSLVDLIESNSRYASLKESLSGYVRGSDEYFIELFKLLPLSSWPTYKTFLRKQAI
QVENSQYNGFSPVYRSSLSPDRLVTCVDQEVFPSAYHHFKFAVRNWPDNDCLGYRPFDPL
TGKWESYYQFESYADVDKRIQNIGSGILTLVNSRNRHQDSNKDVTVPLDSNDFIVSILSH
NRMEWVLTDLACQAYSLANTALYETLGPTTSEYILNLTESPVLVFAKSNFFKIISILPKL
KFLRTLICMDDLSNEELTILNDSILSQKLNSNKESVKLFSLKQVEMIGSLNHIPEILPLQ
DSLYTISFTSGTTGVPKGVEMTHQNVTAGIAFGYSTFKIPTHKVGLQLHDMCFLPLAHIF
QRMIVSYDIATGTGIGFIHKPDPTVLVEDLNLLKPDTLSLVPRVLTKFEAGIKNSMDKSS
FQRNVATNILESKQARFTSKGGPDKSVINYLVFHRVLIDKIRESLGLVNASYLVTGSAPI
SNETLLFLRSALDVGMRQGYGLTETFAGICLCEPHERDPGTCGAIGISSECRLKSVPQMG
YHADKDYKGELQVRGPQVFKHYYKNDVETKRVIDEEGWFSTGDIAFIDKKGRISVIDRVK
NFFKLAQGEYVAPEKIENIYLSSCPHITQIFLYGNSLKTYLVGIVGIDPDSVQLLISKKY
PQAKAWTPAQLIENINSDIALKRHLLILLNKDVNALQGFEKLHNIYVDLEPLTVEDDVIT
PTLKIKRHKATKHFKKTLDALYEEGSMIKNGKL
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacctgattattcgttagtggaccttattgagagcaattcacgttatgcaagc
ttgaaagaatcactttccggttatgtccgtggttctgatgaatattttatcgaattgttc
aagttgctacctttgagcagttggcccacttataagacattccttaggaaacaggccatt
caagtagaaaattctcaatataatgggttcagtcccgtttatcgaagttcgttatcccct
gacagattggttacttgtgttgatcaagaagttttccccagtgcataccatcattttaaa
tttgcagttagaaattggcctgataacgattgtttaggttatagaccttttgatccgtta
actgggaaatgggaatcttactatcaatttgagtcatatgcagatgtagataaacggatt
caaaatatagggtcaggtatattgacacttgtaaattctagaaataggcatcaggattca
aataaggacgttaccgtacccttagattcaaatgattttattgtatcaatattatcgcat
aatcgaatggaatgggtccttactgatttagcatgccaagcttattcattggcaaacaca
gcgttgtatgaaactttgggacctactacctcagaatatattttaaacttgactgaatcc
ccagtcttggtctttgccaaatcaaatttttttaagatcatctctatcttaccaaaatta
aagtttttgagaactttaatttgtatggacgatttatcgaatgaagaattaacaatttta
aatgattcaattttgtctcaaaagttgaattctaataaggaatccgttaaattattttct
ttaaaacaggtggaaatgattggttccttaaatcatatcccagagattctaccattacaa
gattcactgtacacaatatcatttacttcaggcactacaggtgttcccaaaggtgtggaa
atgacccatcaaaatgttacagctggtatagcatttggctattctacgtttaaaatacca
acacataaagtgggtctacaattacatgatatgtgcttcttaccattagcacatattttc
caaagaatgatcgtttcttatgatattgctactggaacaggtattggctttattcataaa
ccagacccaacggttttagtggaggatttgaacctcttgaagccagacactctttcttta
gttccaagagtattaactaaatttgaggcaggaattaaaaactccatggataaatcatct
ttccaaaggaatgttgcaacaaatatcttggaatccaaacaagcaaggttcacatcaaaa
ggtgggccagataagtcagtgattaattatctagtattccatagagttttaatagataag
atcagagaatcattagggcttgtaaatgcttcatatttagtcactggttctgctccaata
tctaatgaaacactattatttttaagaagtgctttagatgttggtatgagacaaggttat
gggttgaccgaaacttttgctggtatttgcttgtgtgaacctcatgagagagaccctggt
acttgtggggccattggtatatcttcagaatgcagattaaaatcggtccctcaaatgggt
tatcatgctgataaagattataaaggtgagttacaagttcgtggtcctcaagtatttaaa
cattattataagaatgatgtggaaactaaaagagtcattgatgaagaaggctggttttca
acaggtgatattgcattcatcgataaaaagggaagaatctcggttattgatcgtgtaaaa
aatttctttaaattggcacagggtgaatatgttgctcctgaaaagattgaaaatatctat
ttatcttcatgcccacatataacacaaatattcttatacggaaattcattgaagacatat
ctcgttggtatcgtgggtatcgatccagattctgtacaattactcatatcaaagaaatac
cctcaggcaaaggcttggactcctgctcagttgatcgagaacattaattcagatatcgca
ttaaaacgccatctattaatcttactaaataaagatgtcaatgcattacaaggatttgaa
aaattacataacatttatgtggatttagaacccttgactgtagaggatgacgtgatcact
ccaactttgaaaattaaaagacacaaggctacaaaacattttaagaaaactctagatgca
ttgtatgaagaaggttccatgattaaaaatgggaaattataa

DBGET integrated database retrieval system