KEGG   Tetrapisispora blattae: TBLA_0G02330Help
Entry
TBLA_0G02330      CDS       T02489                                 

Gene name
TBLA0G02330
Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
tbl  Tetrapisispora blattae
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tbl01009]
    TBLA_0G02330 (TBLA0G02330)
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     TBLA_0G02330 (TBLA0G02330)
Protein phosphatases and associated proteins [BR:tbl01009]
 HAD phosphatases
  Other HAD phosphatases
   TBLA_0G02330 (TBLA0G02330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD
Motif
Other DBs
NCBI-GeneID: 14497305
NCBI-ProteinID: XP_004181692
UniProt: I2H721
Position
7:complement(602155..602877)
Genome map
AA seq 240 aa AA seqDB search
MTNSNSIRKNIKACLFDMDGLLLNTEDIYTITANEALKKYGKGPFTWDVKMRMQGLPGPE
AGAVAVKHYDLPCTVQEYMDLNAQLQNDYWGKSAFLPGAKELIQYLKSKNIPIALCTSSD
KSKLNKKTDHLKDVFELFDVIVTGDDSRIPKGKGKPFPDVWIAGLAELNEKFNTSITSDE
CLVFEDGKIGVTSGMSFGAFVIWVPHPESYGVLGDTDAFLNGKGELVKSLELFDATQFGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactaatagcaattctatcagaaagaacatcaaagcttgtttgtttgatatggatggt
ctactgctaaatacagaagacatttatacaatcacagctaatgaagctcttaagaaatat
gggaaaggaccattcacctgggatgttaaaatgagaatgcaaggtttacctggtccagaa
gcaggtgctgtagcagttaaacattatgatttgccttgtaccgtgcaagagtatatggat
ttgaatgcacaattacaaaatgactactggggaaaatcagctttcttgccaggtgctaaa
gaattaatccaatatttgaaatcaaaaaacatcccaattgccttatgtacttcatctgac
aaatcaaaactcaataaaaagacagaccatttaaaagatgtctttgaattatttgatgtc
attgtcactggtgatgactcaagaattccaaagggtaaaggtaaaccattccccgatgtt
tggattgcaggtttagctgaattgaatgaaaaatttaatacttcaattacttcagatgaa
tgtcttgtttttgaagatgggaaaattggtgtcacttctggtatgtcttttggtgcattt
gtaatttgggtaccacaccctgaatcttacggcgtattgggtgacactgatgccttctta
aacggtaaaggtgaactagtcaaatcattggaattatttgatgcaactcagtttggtttg
tag

DBGET integrated database retrieval system