KEGG   Tenericutes bacterium MO-XQ: BK010_05540
Entry
BK010_05540       CDS       T05457                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
tbm  Tenericutes bacterium MO-XQ
Pathway
tbm00472  D-Arginine and D-ornithine metabolism
tbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BK010_05540
Enzymes [BR:tbm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BK010_05540
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AUD63076
UniProt: A0A2K8ZVP0
Position
complement(1102728..1104923)
AA seq 731 aa
MIKPNEKLDIKNLLNDLENYRPKRKGWVWRTPNPQTIGPFHYQDVSDSLKNYVALPSARH
LNHIDPQPASTITTEIASGRFEDDIRRMRMAAYHGADHMMVIRTAGQSHMDGLLEGTPQG
VGGVPITRKQVRAQRKALDIIEEEVGRPINYHSYVSGVAGPEIAVMFTEEGVNGAHQDPQ
YNVLYRNINMVRSFVDAAESKKIMAFGELAQIDGAHNANATARDAWKVMPELLVQHGINS
RFSERVGIKPDLICLSTVPPAAPPSPDIKLNLPYALALREFFSNYKMRAQMNTKYMDSST
REATVTHVLNLLISKLTSADIQSTITPDEGRNVPWHMFNIEALDTAKQAMVGMDDLMSML
TFKTDGDLFKTKRELEERAILMMEEIIEMGGYFKAVEAGMFVDSGLYPERMGDGIKRAID
GGIGSDTTYKRAKDYMAPVSAHYGFNNIEQYGLNDHPESLIDGSTFEKPDKIQFIDELDE
EDNVNNRMEQTKAYRNTNLIKPEVQWLGDGVVTVDLFFPTDKDTAEAAALEVGKKMNLSN
VEVIHVEVLHPSEGTRIQFKGVFDMDIDVTQLKIVKKEENLPEKEIMAYVKKHNLKIVAG
TGGNDEHSVGMREILDIKHGGIEKYGINYTYLGTSVPIEKFIDAAIEIDAACVMISLIIS
HDDIHYKNMQKLNDYAIEKGVRDKLILIAGGTQVTPELAKSYGMDQGFGRGTKGIDVASF
IVKQHKKIYES
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgattaaaccaaatgaaaaacttgatattaaaaacctattaaatgatttagaaaactat
agaccaaaaagaaaaggatgggtatggagaacacctaatccacaaaccataggacctttt
cattatcaagatgtaagtgattctttaaaaaattatgtagcacttccaagtgctagacat
ttaaatcatattgatccacaaccagcatctacaattacaacagaaatagcttctggaaga
tttgaagatgatattagacgtatgcgtatggctgcatatcatggtgcagatcatatgatg
gttattagaactgctggtcaatcacatatggatggtctacttgaaggaacacctcaaggt
gttggtggtgtacccattacaagaaaacaagtgagagctcaaagaaaagcacttgatatc
attgaagaagaggtaggtagaccaattaattaccactcttatgtttctggtgttgctggt
cctgaaatcgctgtaatgtttactgaagaaggagttaacggtgcacatcaagaccctcaa
tataatgttttatacagaaatatcaatatggttagaagttttgttgatgctgctgaatca
aagaaaatcatggcatttggtgaactagcacaaatcgatggtgcacataatgcaaatgcc
acagcaagagatgcttggaaagtcatgccagaacttcttgttcaacacggcattaattca
agatttagtgaacgtgtcggtatcaagccagatctaatttgtttatcaacagttccgcct
gctgccccaccaagtccagatattaaattaaatctaccttatgcacttgcacttcgtgag
ttttttagcaattataaaatgcgtgcacaaatgaatacaaaatatatggattcatcaacg
agagaagctacagtaacgcatgttctaaacttactgatctcaaaattaacttctgcagat
attcaatctaccattacacctgatgaaggtcgtaatgtcccatggcatatgtttaacata
gaagcattagatacagctaaacaagccatggttggtatggatgatttaatgagtatgtta
acgtttaaaacagatggagatctttttaaaacaaagcgtgagttagaagaaagagctatt
ctaatgatggaagaaatcattgaaatgggtggttattttaaagctgtagaagccggtatg
ttcgtcgatagtggattatatccagaacgtatgggcgatggcattaaacgtgcgattgat
ggtggtatcggtagtgatactacatataaacgtgctaaagattatatggcaccagtatct
gcacattatggatttaataatattgaacaatatggattaaacgatcatccggaatcattg
attgatggatctacttttgaaaaaccagataaaattcagttcattgatgaacttgatgaa
gaagataatgttaataatcgcatggaacaaacaaaagcttatagaaacacaaaccttatc
aaaccagaagttcagtggttaggtgatggtgttgttacggttgatttatttttcccaaca
gataaagatactgcagaagctgcagctttagaagttggtaaaaagatgaatctatcaaat
gtcgaagtcattcatgttgaagtcctacatccaagtgaaggaacacgtatccagtttaaa
ggtgtttttgatatggatattgatgtaactcaattaaaaattgttaaaaaagaagaaaac
ctaccagaaaaagaaatcatggcttatgttaaaaaacataacttaaagattgttgctggt
acaggtggaaatgatgaacatagtgttggtatgagagaaattctagatattaaacacggt
ggtattgaaaaatacggtatcaattatacttatttaggaaccagtgtaccaattgagaaa
tttattgatgcagccattgaaattgatgcagcctgtgtcatgatttcacttattatttct
catgatgatattcattataaaaatatgcaaaaacttaatgattatgccattgaaaaaggc
gttagagataaactgatcttaatcgctggtggtacacaagtgactccagaacttgcaaaa
tcttatggcatggatcaagggtttggaagaggaacgaaaggaattgatgttgcttcattt
attgtgaaacaacacaaaaagatctatgaaagttga

DBGET integrated database retrieval system