KEGG   Tenericutes bacterium MO-XQ: BK010_05545
Entry
BK010_05545       CDS       T05457                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
tbm  Tenericutes bacterium MO-XQ
Pathway
tbm00472  D-Arginine and D-ornithine metabolism
tbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BK010_05545
Enzymes [BR:tbm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BK010_05545
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AUD63077
UniProt: A0A2K9AHE2
Position
complement(1104916..1105278)
AA seq 120 aa
MKARKDDFEQRRSHLKNMSDQELKTYFYKLLDDMIDPILDLAYTHTSPSIERSVLLRMGF
SSLESKALVDLILENNLIKHGAGHVIYKYAQKEQLDIREAGLKLLETHNLDSIKGAFKND
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaagctagaaaagatgatttcgaacaaagacgttctcatttgaaaaacatgtcagat
caagaactaaaaacttatttttataagttactagacgatatgattgatccaatcttggat
ttagcatatacccatacgtcaccttcaattgaaagaagtgttttattacgcatggggttt
tcttctttagaatcaaaagcacttgttgatttgattttggaaaataatcttattaaacat
ggcgcaggtcatgtaatttataaatatgcacaaaaagaacaattagatattagagaagct
ggcttgaaattactggaaacacacaatctagatagtatcaagggggcattcaaaaatgat
taa

DBGET integrated database retrieval system