KEGG   Thiolapillus brandeum: TBH_C0469Help
Entry
TBH_C0469         CDS       T03600                                 

Definition
(GenBank) long-chain acyl-CoA synthetase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
tbn  Thiolapillus brandeum
Pathway
tbn00061  Fatty acid biosynthesis
tbn00071  Fatty acid degradation
tbn01100  Metabolic pathways
tbn01212  Fatty acid metabolism
tbn02024  Quorum sensing
Module
tbn_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:tbn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TBH_C0469
   00071 Fatty acid degradation
    TBH_C0469
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TBH_C0469
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tbn01004]
    TBH_C0469
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tbn04147]
    TBH_C0469
Enzymes [BR:tbn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     TBH_C0469
Lipid biosynthesis proteins [BR:tbn01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   TBH_C0469
Exosome [BR:tbn04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   TBH_C0469
  Exosomal proteins of breast cancer cells
   TBH_C0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: BAO43414
UniProt: W0TMP9
Position
493134..494969
Genome map
AA seq 611 aa AA seqDB search
MKKFHENIISAEEAVTLDGLFARRLHRSPDGLAYQYHDKPSKAWKSYSWAEMAAQVARWQ
QALANEGLREEDRVAVLLRNCPEWVMWDQAALSLGLVTVPLYTDDRPDNIAYILEEAGVK
ALLVQDAGRWKRLVPVLPEESDGRLKRVVLLDSSKEAEKFARNDDRIRLARDWLPDDGGD
LRVRRNADPHSLASIVYTSGTTGRSKGVMLSHHNMLSVAHGGLTLLDCYEEDVFLSFLPL
SHTLERTAGYYLPIMAGSSVAYARSVAQLGDDLLKIRPTVLIAVPRIFERVYGKIKDQLK
KKPAIARKLFNMAVDVGWARFLHQQGRGRWSPRFLLWPLLNKLVASNVVAKLGGRLRAAV
SGGAPLSPDIAKVFIGLGIPIVQGYGLTETSPVISVNSLEDNIPDSVGVPIRGTEVKIGA
NDELLVRGPGVMCGYWNNHKATTETIDPDGWLHTGDQARIENDHIFITGRLKDILVLSNG
EKIPPADMELAIALDPIIEQVMVVGEGRPYLTALVVLNEENWPGLAREYGLDPADPASLE
DKKLHGAVLRRIKASLKDFPGYAKIRQLRLLLEPWTIEEGLITPTLKVKRPKVLEKYASE
VESMYSGGPTN
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaattccatgaaaatattatttccgccgaagaagcggtcactctcgacgggttg
ttcgcccggcgcttgcatcgctcacccgatggattggcctatcagtatcatgataagccg
agcaaagcctggaaaagctactcctgggcggagatggcggcccaggttgcccgttggcag
caggccctggccaatgagggtctgcgcgaagaggaccgggtggcggttctgctgcgcaat
tgccccgagtgggtgatgtgggaccaggccgctctcagcctgggactggtcactgtgccc
ctgtacacggatgaccggcccgacaacattgcctatatcctggaagaagccggcgtgaag
gctctattggtacaggatgctggccgctggaaacgcctggtgccggtattgccggaggaa
agtgatgggcgcctgaaacgggtggtgttgctggatagcagcaaagaggcggaaaaattt
gcccgtaatgatgatcgcatccgcctggcccgggattggctgccggatgatggcggtgac
ctgcgggtgcgccgcaatgcggatccccattccctggcgtccattgtctatacctcagga
accacggggcgttccaagggcgtgatgctcagtcaccacaatatgctctccgtggcccac
ggggggctgactctgctggattgctatgaagaagacgtgttcctgtcctttctgcccttg
tcccatactctggaaagaacggcgggctactacctgcccatcatggcgggttccagtgtg
gcctatgcccgttccgtagcgcaactgggcgacgatttgctgaagatacggcccacggtg
ctgattgccgtgccacgtatcttcgagcgcgtgtacggcaagatcaaggatcagctgaag
aagaagcctgccatcgcgcgcaagctttttaatatggcagtggatgtggggtgggcgcgc
ttcctgcatcagcagggccggggacgctggtcccccaggttcctgctttggcccctgctc
aacaagttggtggcaagcaacgtggtcgccaagttggggggacgtttgcgtgctgccgtg
agcggcggggcacccctgtccccggacattgccaaggtttttatcggcctggggattccc
atcgtacaaggctatggccttacggaaaccagccccgtgatcagcgtcaattccctggaa
gacaacataccggacagcgtgggtgtgcctattcggggtaccgaggtaaagatcggggcc
aatgatgaactgctggtgcgggggccgggagtcatgtgcggatactggaacaatcacaag
gccactaccgagaccatcgatccggacggttggctgcacaccggtgatcaggcgcgtatc
gaaaacgaccatattttcatcaccgggcgcctgaaggatattctggtgttgtccaatgga
gaaaagatccctccggcggatatggagctggccattgccctggatccgatcatcgagcag
gtcatggtagtgggtgaggggcgcccctatctcacggctctggtagtcctcaatgaagaa
aactggccggggctggcccgggaatatggattggatccggcggatccggccagcctggag
gacaagaaactgcatggggccgtgttgcggcgcatcaaggcgtctctgaaggattttcct
ggctatgccaagatacgccagctacgtctgttgctcgaaccctggactatcgaggaagga
ctgatcaccccgactctcaaggtcaaacgccccaaggtactggaaaaatatgcttccgaa
gtggagtccatgtactcgggtggaccaaccaactga

DBGET integrated database retrieval system