KEGG   Thiolapillus brandeum: TBH_C1747Help
Entry
TBH_C1747         CDS       T03600                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tbn  Thiolapillus brandeum
Pathway
tbn00280  Valine, leucine and isoleucine degradation
tbn00310  Lysine degradation
tbn00362  Benzoate degradation
tbn00380  Tryptophan metabolism
tbn00620  Pyruvate metabolism
tbn00630  Glyoxylate and dicarboxylate metabolism
tbn00640  Propanoate metabolism
tbn00650  Butanoate metabolism
tbn00900  Terpenoid backbone biosynthesis
tbn01100  Metabolic pathways
tbn01110  Biosynthesis of secondary metabolites
tbn01120  Microbial metabolism in diverse environments
tbn01130  Biosynthesis of antibiotics
tbn01200  Carbon metabolism
tbn01212  Fatty acid metabolism
tbn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBH_C1747
   00630 Glyoxylate and dicarboxylate metabolism
    TBH_C1747
   00640 Propanoate metabolism
    TBH_C1747
   00650 Butanoate metabolism
    TBH_C1747
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TBH_C1747
   00072 Synthesis and degradation of ketone bodies
    TBH_C1747
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBH_C1747
   00310 Lysine degradation
    TBH_C1747
   00380 Tryptophan metabolism
    TBH_C1747
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TBH_C1747
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBH_C1747
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TBH_C1747
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tbn04147]
    TBH_C1747
Enzymes [BR:tbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TBH_C1747
Exosome [BR:tbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBH_C1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAO44664
UniProt: W0TR61
Position
1912184..1913497
Genome map
AA seq 437 aa AA seqDB search
MKPVSQNPYEHHEVYIVDGRRTPQLKVMGPPGPFRASDLAVSAARQLLLTLPFPADALDE
VIFGCVSSGPDEANIARVIALRLGCGDKVPAMTVQRNCASGMQAQDCAAARIASGQADLI
LAGGTEAMSHHPVLLNNAMVTWLAQWNQARNLKQRARVLGKLKPGYLQPIIALLRGLTDP
VVGLSMGQTAEQLAEDFGISREAMDRFALRSHQRLAAAVEAGHLEEIVPLIDSKGNVYSK
DNGLRPDSTMEKLARLKPVFDRPFGKVTAGNSAQVTDGAACLLLASTRAVEKHDLPVLGR
LRECHWAGLEPERMGLGPVYAMAPIMANQQLNTEDIDYWEINEAFAAQILACLQAWQDEN
FCRNHLNLSQAFQAISEDHLNVDGGGISLGHPVGASGARIVLHLLKTLERKNARLGMASL
CIGGGQGGAMLVERSPS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtttcccaaaacccttacgagcaccatgaagtgtacatcgtcgatggccgc
cgcaccccccagctcaaggtcatggggccacccggccccttccgcgccagcgacctggcc
gtgagtgcggcccgtcaactgctactcaccctgcctttccctgccgatgcactggatgaa
gtcatcttcggctgtgtatcctccggtcccgatgaagccaacatcgctcgggtcatcgcc
ctgcgcctaggctgcggcgacaaggtgcctgccatgaccgtacagcgcaactgcgcctcg
ggcatgcaagcccaggattgcgccgctgcgcgtattgccagcggccaggcggatctgatt
ctggccgggggtaccgaggccatgagccatcatcccgtgttgctcaacaacgccatggtg
acctggctggcccagtggaatcaggcacgcaacctgaaacagcgggccagggttctgggc
aagctcaaacccggctatctgcagcccatcatcgccctgttacgcggccttacggatcct
gtggtgggcctgtccatggggcagactgccgaacagctggcggaagacttcggcatcagc
cgtgaagccatggatcgcttcgctctgcgcagccaccagcgtttggcagccgccgtggaa
gccggtcacctggaagagatcgttcccctgatcgactccaaggggaatgtctattccaaa
gacaatggcctgcgcccggacagcaccatggagaaactggcacgcctcaaacccgtcttt
gaccggcccttcggcaaggtcactgcaggtaacagcgcccaggtcacggacggtgccgcc
tgcctgcttctggcctccacccgagccgtggagaaacatgatctgcccgtgctcggccgt
ttgcgtgaatgccattgggccgggctggagccggaacgcatgggtctggggcctgtgtat
gccatggcacccatcatggcgaaccagcagctgaacacggaagacatcgactactgggag
atcaatgaagcctttgccgcacagatactggcctgcctgcaggcctggcaggatgaaaat
ttctgccgcaaccacttgaacctttcccaggctttccaggccatttcagaagaccatctc
aacgtggacggcggcggcatcagcctcggacatcccgtaggcgcatccggcgcccggatc
gtgctgcatctgctcaagaccctggaaaggaagaacgcccgcctgggcatggccagcctg
tgcataggtggtggccagggtggcgccatgctggttgaaaggagcccgtcatga

DBGET integrated database retrieval system