KEGG   Thiolapillus brandeum: TBH_C2051Help
Entry
TBH_C2051         CDS       T03600                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
tbn  Thiolapillus brandeum
Pathway
tbn00780  Biotin metabolism
tbn01100  Metabolic pathways
Module
tbn_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:tbn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TBH_C2051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbn01007]
    TBH_C2051
Enzymes [BR:tbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     TBH_C2051
Amino acid related enzymes [BR:tbn01007]
 Aminotransferase (transaminase)
  Class II
   TBH_C2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAO44965
UniProt: W0TNK4
Position
complement(2235840..2236988)
Genome map
AA seq 382 aa AA seqDB search
MKDLRPALVQAQQGHLYRRRRVLDSPQQPRLVVEGRPLLSFCSNDYLGLAADPRVSKAFH
RGLEHWGSGSGSAHLVSGHSRAHHALEEELADFTGRERALLFSSGYLANLAVVTSLCGRG
DTVIQDKLDHASLIDAARLSGAGLKRYAHNDMAAARQRLAAARGEVLLAVDGVFSMDGDL
APLPELADLASQHGAWLMVDDAHGLGVLGAGGRGSLAHFGLDADHAPVLMGTLGKAFGTA
GAFVAGSEALIETLIQKARSYIFTTALPAALAEATRASLEILRAEEWRRERLASLVARFR
RGAAEMGFKLSASATPVQPLIAGRAQTALAWSRLLEEQGILVTAIRPPTVPKGSARLRIT
FSAAHEDRDLDQLLAALESLKP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatctgcggccagccctggtgcaggctcagcaagggcatttgtaccgccgccgc
cgggtgttggacagcccccagcaaccccgcctggtggtggagggccgtcccctgctgtct
ttctgcagcaatgattatctgggactggcggcggatccccgggtgtccaaggcttttcac
cggggcctggaacactggggcagcggtagcggttctgcccacctggtcagcggccatagc
cgcgcccatcatgccctggaagaagaactggcggattttaccggccgggagcgggccttg
ttgttttccagcggctacctggccaacctggccgtagtcaccagtctgtgtggccggggt
gatacggtgatccaggacaagctggatcatgcttctctcatcgatgccgcccgcctcagc
ggtgccgggctgaagcgctatgcccacaatgacatggcggccgcgcgccagcgcctggct
gccgcccggggagaggtgttgctggcggtggacggggtattcagtatggatggtgacctg
gcgccgttgccggaactggcggatcttgcaagccagcacggggcctggctcatggtggat
gatgcccatggcctgggagtgttgggcgcaggcgggcggggcagtctggcccatttcggc
ctggatgcggatcatgcgccggtactcatgggcaccctgggcaaggctttcggcactgcc
ggggcgttcgtcgcaggcagcgaggctctcattgaaaccctgatccagaaggctcgcagc
tacattttcaccaccgcccttcctgcggccctggcggaagccactcgggccagcctggaa
atactcagggccgaggaatggcgccgggagcggctcgccagcctggtggcgcggtttcgc
cggggagcggcggagatggggttcaaattgtcggcttccgccactcctgtccagcctctt
attgccggtcgggctcagacggctctggcctggagccgtcttctggaggagcagggcatt
ctggtgaccgccatccgaccgcccacagtgcccaagggcagcgcacgtttgcgcattact
ttcagcgcggctcatgaagacagggatctggatcagcttctggcggcgctggagagcctc
aaaccatga

DBGET integrated database retrieval system