KEGG   Thiolapillus brandeum: TBH_C2083Help
Entry
TBH_C2083         CDS       T03600                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tbn  Thiolapillus brandeum
Pathway
tbn00450  Selenocompound metabolism
tbn00970  Aminoacyl-tRNA biosynthesis
tbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TBH_C2083
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TBH_C2083
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tbn01007]
    TBH_C2083
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tbn03016]
    TBH_C2083
Enzymes [BR:tbn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TBH_C2083
Amino acid related enzymes [BR:tbn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TBH_C2083
Transfer RNA biogenesis [BR:tbn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TBH_C2083
 Prokaryotic type
   Other AARSs
    TBH_C2083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BAO44995
UniProt: W0TNN3
Position
2271187..2273205
Genome map
AA seq 672 aa AA seqDB search
MRKILVTSALPYANAPLHIGHIVEYTQTDIWSRFQKMRGNQCWYICADDSHGTPIMLHAR
QKGISPEALIAAMSEEHQADFRDFRIGFDNFHSTHSDENRELASLIYERNLAAGHITSRR
IVQAYDPEEKMFLPDRFIKGECPKCGAADQYGDNCEACGATYSPTELKNAYSVVSGAKPV
EKETEHFFFKLADFEDMLKAWTRGGHLQPEVANKLDEWFEAGLREWDISRDAPYFGFEIP
GHPGKYFYVWLDAPIGYMASFKNFCRKKGLDFDEYWAEGSDTELYHFIGKDIIYFHALFW
PAMLHGAGFRKPTTIHAHGFLTVDGQKMSKSRGSFIKARTYLDNLNPEYLRYYFAAKLGS
GVDDIDLNLEDFVQRVNSDLVGKVVNIASRCAGFISKRFEGRLSAELPEPALFKAFTDAS
KSIAEHYEKREFSRAVREIMALADKANQYIDEKQPWVVAKEEGREQELQDICSMGINLFK
VLMVYLRPILPGTAEDAEAFLNLDALQWDDAHTPLLGHEINKFKALMTRVDPKKVAAMVE
ASKEDMQAKPQKAAPRQKAQDAIADTIEFDDFAKVDLRVARITRAQAVEGADKLLQLTLD
LGGETRNVFAGIKAAYDPAELEGRLTVMVANLAPRKMRFGVSEGMVLAAGPGGKDIFILS
PDEGAQPGMKVK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatactcgtcaccagcgccctcccctatgccaacgcgcccctgcacatcggc
cacatcgtggaatatacccagaccgacatctggtcccgctttcagaagatgcgcggcaac
cagtgctggtatatctgcgccgatgactcccatggcactcccatcatgctccacgcacgg
cagaaaggtatttctccggaagcgctgatcgccgccatgtccgaggaacaccaggcggat
ttccgtgatttccgtattggcttcgacaattttcacagtacgcattccgacgaaaaccgt
gaattggccagcctcatctacgagcgtaacctggcagcgggccacatcaccagccgcagg
atcgtgcaggcctatgatccggaagaaaagatgttcctcccggaccgcttcatcaagggc
gaatgccccaagtgcggcgcagccgaccagtacggtgacaactgcgaagcctgtggcgcc
acctacagtcccacggagttgaagaacgcctattccgtggtttccggggccaaacccgtg
gagaaagaaaccgaacacttctttttcaagctggcggattttgaagacatgctcaaggca
tggacccggggtggccatctgcagccggaagtggccaacaagctggacgagtggttcgag
gcgggtctgcgcgagtgggacatcagccgcgatgccccctatttcggcttcgagattccc
ggccatccaggcaagtatttctacgtctggctggatgctcccatcggctatatggccagt
ttcaagaatttctgccggaagaaaggcctggatttcgacgaatactgggcggaaggatca
gacaccgagctgtaccatttcatcggcaaggacatcatctatttccacgccctgttctgg
cccgccatgctccatggcgcgggcttccgcaagcccaccaccatccacgcccacggcttt
ctcacggttgacgggcagaaaatgtccaaatcacggggcagcttcatcaaggcccgcacc
tacctggacaatctcaatcccgagtacctgcgctactacttcgccgccaagctgggttcc
ggcgtggatgacatcgacctgaatctggaagacttcgtgcagcgggtcaattccgacctg
gtgggcaaggtggtgaacatcgccagccgctgcgccgggttcatcagcaagcgtttcgaa
ggccggctctccgccgagctgcccgaacccgcgctgttcaaggcattcaccgacgccagt
aaatccatcgcggaacattacgaaaagcgcgagttcagccgcgccgtgcgcgagatcatg
gccctggcggacaaggccaaccagtacatcgacgaaaaacaaccctgggtggtggccaag
gaagaaggccgggaacaggagctccaggacatctgttccatgggcatcaacctgttcaag
gtgctcatggtctatctgcgccccatactgccgggtaccgctgaagacgccgaagccttc
ctgaacctggacgccctgcagtgggacgatgctcacacccctctgctcggacacgaaatc
aacaagttcaaggccctgatgacccgggtggacccgaaaaaggtcgctgccatggtcgag
gcttcgaaagaagacatgcaggccaagccgcaaaaagccgcgcccaggcaaaaagcgcag
gatgccattgccgataccatcgagttcgatgacttcgccaaagtggacctgcgcgtggcc
cgcatcaccagggcccaggccgtggaaggcgcggacaagctgctgcaactcaccctggat
ctgggaggggaaacccgcaacgtcttcgccggtatcaaggcggcttacgaccccgccgaa
ctggaaggccgactgacagtcatggtcgccaacctcgccccccgcaagatgcgcttcggc
gtatccgaaggtatggtgctggccgccggccccggtgggaaagacatcttcattctcagt
ccggatgaaggcgcacagccgggaatgaaggtcaaataa

DBGET integrated database retrieval system