KEGG   Thermoanaerobacter brockii: Thebr_0023Help
Entry
Thebr_0023        CDS       T01409                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00740  Riboflavin metabolism
tbo00790  Folate biosynthesis
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Thebr_0023
   00790 Folate biosynthesis
    Thebr_0023
Enzymes [BR:tbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Thebr_0023
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Thebr_0023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADV78655
UniProt: E8USW7
Position
25837..27027
Genome map
AA seq 396 aa AA seqDB search
MFDRIEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGEHINFMIKYGRGLVCVPMT
EKRLNELGIYQMVENNTDHKETAFTVSVDYKECTTGISAFERALTVKKLVDDNSKPEDFT
KPGHIFPLRAKDGGVLVRAGHTEAAVDLAVLAGLKPAGVICEIIKDDGNMARLPDLLEFA
KKFGLRIISIEDLIKYRMKNEILVRRVAQAKLPTKYGNFEIVGYEEILTRKQHVALIKGD
INKEPVLVRIHSECLTGDILGSLRCDCGDQLHAAMERIGQEGGVLVYLRQEGRGIGLLNK
IKAYHLQDQGLDTVEANIKLGFPPDLREYSIAAQILKDIGVKKIRIMTNNPQKIMELSDY
GLDVVERVSIEICPNHYNEKYLKTKKERMGHLILEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataggatagaagatgcaatagaagatataaagcaagggaaaatgattattgtg
gtagatgatgaaaatagggaaaatgaaggcgacttagttatggcagcagaaaaagttaca
ggagaacacattaattttatgataaaatatggacggggtcttgtatgtgttccgatgaca
gaaaagagacttaatgagcttggcatttaccaaatggttgagaataacactgaccataaa
gaaactgcttttactgtatctgtagattataaagaatgtaccactggtatttctgcattt
gaaagagcactgacggtgaagaaattagtagatgataattcaaaaccagaagattttaca
aagccgggacatatttttcctttaagagccaaagatggtggtgtattagtaagagcaggg
catacagaagcggctgtagaccttgcagttcttgcaggactcaaacccgctggagtaata
tgcgaaatcataaaagacgatggaaatatggcaaggttgcctgaccttttggagtttgca
aaaaaatttggattgagaattatatctattgaagatttgataaagtacagaatgaaaaat
gaaatacttgtgagaagggtagcgcaggcgaaacttccaactaagtatgggaattttgaa
attgttggatatgaagaaatattaacaaggaaacagcatgtagctttgattaaaggagat
ataaataaagaacctgtacttgtgaggatacattctgaatgtcttacaggggatatcttg
gggtcgttaagatgtgactgtggtgaccagcttcatgcggcaatggaaagaataggacag
gaaggaggagtactagtttatctgaggcaggaaggaaggggtataggacttttaaacaag
attaaagcgtatcatctgcaggatcaagggcttgatactgttgaagcgaatattaagctt
ggttttccacccgatttaagagaatacagtatagctgcacagattttgaaagatatagga
gttaaaaagataaggattatgacaaataatccgcaaaaaattatggaattatcagactat
ggtcttgatgttgtagaaagggtttctatagaaatttgtccaaatcattataatgaaaaa
tacctcaaaacaaaaaaggaaagaatgggacatctaattttggaagtgtaa

DBGET integrated database retrieval system