KEGG   Thermoanaerobacter brockii: Thebr_0222Help
Entry
Thebr_0222        CDS       T01409                                 

Definition
(GenBank) glutamate synthase (NADPH), homotetrameric
  KO
K00266  glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00250  Alanine, aspartate and glutamate metabolism
tbo00910  Nitrogen metabolism
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
tbo01120  Microbial metabolism in diverse environments
tbo01130  Biosynthesis of antibiotics
tbo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Thebr_0222
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thebr_0222
Enzymes [BR:tbo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Thebr_0222
    1.4.1.14  glutamate synthase (NADH)
     Thebr_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 AlaDh_PNT_C Thi4 NAD_binding_7 HI0933_like F420_oxidored FAD_oxidored FAD_binding_3 2-Hacid_dh_C FAD_binding_2 DAO GIDA Amino_oxidase Shikimate_DH K_oxygenase Lycopene_cycl NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ADV78849
UniProt: E8UU39
Position
complement(241681..243081)
Genome map
AA seq 466 aa AA seqDB search
MPLNRSKKKTPMPTQKPEVRRRNFNEVALGYSEEEAVSEAQRCLQCKKPGCVEGCPVQVQ
IPQFIKRIAERDFEGAIKIIKETNSLPAICGRVCPQETQCEKNCVLGKVGEPVAIGRLER
FAADWERAKGIRPPVIPKKLGKKVAIIGSGPAGLTCAGDLAKLGYDVTIFEALHKPGGVL
VYGIPEFRLPKIIVEQEVKFIQQLGVEIKTNMVMGKVLTIDDLFEMGYEAVFIGTGAGLP
KFMGIPGENYLGVYSANEFLTRINLMKAYSFPNTDTPIKVGKKVAVIGGGNVAMDAARSA
LRMGADEVHIVYRRSEEEMPARKEEFENAKEEGIIFDFLTNPVRIIGNENGWVKGIECIR
MELGEPDASGRRRPVPITGSEFIMDVNTVVIAIGTGPNPLLTKTTEGLELTKHGYIAVDE
EGRTSREGVWAGGDIVTGSATVILAMGAGKKAARSIHEYLQNKKWR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccgttaaatagaagcaaaaagaaaacacccatgcctacccaaaagcctgaagtccgc
aggcgtaattttaacgaagtagctttgggctattcggaagaggaggcagtaagtgaagcc
cagaggtgtcttcagtgtaaaaaaccaggatgtgttgaagggtgccccgttcaggtacaa
attccccagtttataaagcgtattgcagaaagagattttgaaggagctataaagattata
aaggaaaccaacagcttgcccgccatatgtggcagagtctgtccacaagaaacgcaatgc
gagaaaaactgtgttttgggcaaagtaggtgaacctgtggccataggtcgcctagaacgg
tttgcagcagactgggaaagagccaaaggcatccgtcccccggtaattcctaaaaagctt
ggtaaaaaagtggccatcatcggttccgggcccgccggtctcacctgtgcaggagatttg
gctaaactcggctacgatgtaacgatctttgaagctcttcacaaacccggtggcgtactg
gtatacggtattcctgaattcaggctaccgaaaattatagtggaacaagaagtaaagttt
atacaacagctgggcgtagaaattaaaaccaacatggttatgggcaaagttctgacgata
gacgacctttttgaaatggggtatgaggctgtctttatcggcactggagctggcctcccg
aaatttatgggcatacctggtgaaaactacctgggtgtgtattcagccaacgagtttcta
accaggataaacctgatgaaagcctattcttttcccaacactgacacccccataaaggta
ggcaaaaaagtagcagtaatagggggtggcaatgtagctatggatgcagccaggtctgct
ctaagaatgggagctgacgaagttcatattgtgtatcgccgttctgaagaagaaatgccc
gcaagaaaagaagaattcgagaacgctaaagaggaaggtattatatttgatttcctcaca
aatccagtgagaataataggtaacgaaaatggttgggtcaaaggtattgagtgtatccgc
atggaacttggagaacctgacgcttcgggtcgtcgccgtccagttcctataacgggttct
gaatttatcatggatgttaatacggtagtaatcgccataggtactggccctaatcccctc
ctcacaaagaccactgaaggcttagaacttacaaaacacggttatatcgctgtcgatgag
gagggaaggacttccagagaaggggtatgggctggaggcgatattgtaacgggttcagct
actgtaattttggccatgggtgccggaaaaaaagcagctcgctccatccatgaataccta
caaaacaaaaaatggcggtaa

DBGET integrated database retrieval system