KEGG   Thermoanaerobacter brockii: Thebr_0872Help
Entry
Thebr_0872        CDS       T01409                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00030  Pentose phosphate pathway
tbo01100  Metabolic pathways
tbo01120  Microbial metabolism in diverse environments
tbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thebr_0872
Enzymes [BR:tbo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Thebr_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADV79457
UniProt: E8UR60
Position
892670..894469
Genome map
AA seq 599 aa AA seqDB search
MFGYAGKILRVNLTERKFKFEDLNLELAKKYIGGRGLASKIFMDEVDPNVEPLSPENKLI
IATGPLTGTPVPTGGRYMVITKSPLTGTIACSNSGGYFGAELKAAGLDMIIFEGKAESPV
YVAIEDDKVEIRDASHLWGKLVSETTDELKKEYGDKSKVLCIGPAGEKLSRIAAVMNDYD
RAAGRSGVGAVMGSKNVKAIVVKGSKGIKLYDKEKVREVARNKTKMLRENGVTGEGLPTY
GTAVLVNIINEHGIFPVANFQRAYTEHADKISGETMTREILVRKNPCYGCPIACGRWIRL
KDGREVGGPEYETLWAFGADCEVYDINAIAEANYWCNEYGLDTISTGATIAAAMELYEKG
YIKDDEIEKDGYSLKFGDAEAVVGWVKKIGAREGFGDKMAEGSYRLCESYGVPELSMSVK
KQELPAYDPRGAQGHGLEYATSNRGGCHVRGYMISPEILGIPQKLDRFSLEGKAEWVKTF
QDLTAVIDSLGLCLFTSFALGAQDYVDLVNAVCGTDYTAETLLEVGSRIYTLERLFNLKA
GIDPKEDKLPKRLLEEPIPEGPSKGHVHKLSELLPKYYEVRGWDDNGYPTKETLQKLGI
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgggtatgccggcaagatattgagagttaacttaacagaaaggaaattcaaattt
gaagatcttaatttagaacttgcaaagaaatacataggcggaagagggcttgcaagcaag
atatttatggatgaagttgatccaaatgttgaacccctaagtccagaaaataagttaata
attgcaacaggaccacttacaggaacaccagttccaactggtggaagatacatggtaatc
actaaatcaccgttaacaggaactattgcatgttcaaattcaggtggatattttggtgca
gaattaaaggcagcagggcttgatatgattatttttgaaggaaaggcagaaagcccagtt
tatgttgcaattgaagatgataaagttgaaatcagagatgcatcacatctatggggaaag
cttgtttctgaaacaaccgatgaacttaaaaaagaatatggtgataaatcaaaggttctt
tgcataggacctgcgggtgaaaagctttctaggattgcagcggttatgaatgactatgat
agagcagcaggacgttctggtgttggtgctgttatggggtctaagaacgtgaaggcgata
gttgtaaagggttccaaagggattaaattatacgataaagagaaggttagagaagttgct
agaaataaaacaaagatgcttcgcgaaaatggagttacgggtgaagggctaccaacttat
ggaacggcagttcttgtcaatataatcaatgaacacggaatttttccagttgctaatttc
caaagggcctatacagaacatgctgataaaataagcggagaaactatgacaagggaaata
cttgtgagaaagaatccttgttatgggtgtccaatagcttgtggaagatggataagatta
aaggatggccgtgaggtaggaggtcctgaatacgaaactctctgggcatttggtgcagac
tgtgaggtttatgatataaacgctatagctgaagcaaattattggtgcaatgaatatggt
cttgatactatttcaactggagctactattgcagctgctatggaattatatgaaaaggga
tatataaaggatgatgaaatagaaaaagatggatattccttaaaatttggtgatgcagaa
gctgttgttggatgggttaaaaagataggtgcaagggaaggatttggagataagatggca
gaaggttcatatagactttgcgaaagctatggtgtgccagaactttcgatgtcagttaaa
aaacaagaacttcccgcttacgacccaagaggagctcaaggacatggacttgaatatgcg
acttctaacagaggtggttgtcatgtaagaggatatatgatatctcctgaaatattaggt
atacctcaaaagcttgatagattttctcttgagggaaaagctgaatgggttaaaacattc
caagatttaactgctgttatagattcgctgggactgtgcctatttacatcttttgccctt
ggtgctcaagattacgttgaccttgtaaatgcagtttgcggaactgattatactgcagaa
acattattagaggtaggctcaaggatatacacattagaaaggctgtttaatttgaaggca
ggaatcgatccaaaagaggataaactgccaaagagacttttagaagagcctattcctgaa
ggcccatctaaaggacatgttcataaattatcagaactgttaccaaagtattatgaggta
agaggatgggacgataatggatatccaacgaaagaaactttacaaaaattgggaatttga

DBGET integrated database retrieval system